Recombinant Human WFDC1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human WFDC1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 121-220 of Human WFDC1

Source: Wheat Germ

Amino Acid Sequence: KPRWLGGNGWLLDGPEEVLQAEACSTTEDGAEPLLCPSGYECHILSPGDVAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHFQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
WFDC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human WFDC1 Protein

  • ps20 growth inhibitor
  • PS20Prostate stromal protein ps20
  • WAP four-disulfide core domain 1 homolog
  • WAP four-disulfide core domain 1
  • WAP four-disulfide core domain protein 1

Background

This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. The encoded protein shares 81% amino acid identity with the rat ps20 protein, which was originally identified as a secreted growth inhibitor. This gene is mapped to chromosome 16q24, an area of frequent loss of heterozygosity in cancers, including prostate, breast and hepatocellular cancers and Wilms' tumor. Owing to its location and a possible growth inhibitory property of its gene product, this gene is suggested to be a tumor suppressor gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
796-IC
Species: Mu
NBP2-24530
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P, Flow-IC
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80963
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00058189-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for WFDC1 Partial Recombinant Protein (H00058189-Q01) (0)

There are no publications for WFDC1 Partial Recombinant Protein (H00058189-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WFDC1 Partial Recombinant Protein (H00058189-Q01) (0)

There are no reviews for WFDC1 Partial Recombinant Protein (H00058189-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WFDC1 Partial Recombinant Protein (H00058189-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WFDC1 Products

Bioinformatics Tool for WFDC1 Partial Recombinant Protein (H00058189-Q01)

Discover related pathways, diseases and genes to WFDC1 Partial Recombinant Protein (H00058189-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WFDC1 Partial Recombinant Protein (H00058189-Q01)

Discover more about diseases related to WFDC1 Partial Recombinant Protein (H00058189-Q01).
 

Pathways for WFDC1 Partial Recombinant Protein (H00058189-Q01)

View related products by pathway.

PTMs for WFDC1 Partial Recombinant Protein (H00058189-Q01)

Learn more about PTMs related to WFDC1 Partial Recombinant Protein (H00058189-Q01).

Blogs on WFDC1

There are no specific blogs for WFDC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

WFDC1 Antibody
NBP1-87207

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human WFDC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WFDC1