wdyhv1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: wdyhv1 Antibody [NBP1-86722] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: wdyhv1 Antibody [NBP1-86722] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

wdyhv1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSK
Predicted Species
Mouse (91%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDYHV1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
wdyhv1 Protein (NBP1-86722PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for wdyhv1 Antibody

  • C8orf32
  • chromosome 8 open reading frame 32
  • EC 3.5.1.-
  • FLJ10204
  • nt(Q)-amidase
  • NTAQ1
  • N-terminal Gln amidase
  • Protein NH2-terminal glutamine deamidase
  • protein N-terminal glutamine amidohydrolase
  • WDYHV motif containing 1
  • WDYHV motif-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84366
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP1-85950
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81404
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-20191
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1235
Species: Hu
Applications: IHC, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-98549
Species: Hu
Applications: WB
NBP2-15046
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P

Publications for wdyhv1 Antibody (NBP1-86722) (0)

There are no publications for wdyhv1 Antibody (NBP1-86722).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for wdyhv1 Antibody (NBP1-86722) (0)

There are no reviews for wdyhv1 Antibody (NBP1-86722). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for wdyhv1 Antibody (NBP1-86722) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional wdyhv1 Products

Bioinformatics Tool for wdyhv1 Antibody (NBP1-86722)

Discover related pathways, diseases and genes to wdyhv1 Antibody (NBP1-86722). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on wdyhv1

There are no specific blogs for wdyhv1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our wdyhv1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDYHV1
Entrez
Uniprot