WDR77 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: WDR77 Antibody [NBP3-37891] - Immunofluorescence analysis of HeLa cells using WDR77 Rabbit pAb.Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution.

Immunoprecipitation: WDR77 Antibody [NBP3-37891] - Immunoprecipitation analysis of 200 ug extracts of 293T cells using 3 ug WDR77 antibody. Western blot was performed from the immunoprecipitate using WDR77 antibody at a dilution of 1:1000.

Immunohistochemistry: WDR77 Antibody [NBP3-37891] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using WDR77 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: WDR77 Antibody [NBP3-37891] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using WDR77 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: WDR77 Antibody [NBP3-37891] - Immunohistochemistry analysis of paraffin-embedded Human colon using WDR77 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: WDR77 Antibody [NBP3-37891] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using WDR77 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: WDR77 Antibody [NBP3-37891] - Western blot analysis of lysates from 293T cells, using WDR77 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WDR77 Antibody - BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 290-390 of mouse WDR77 (NP_035770.2).
  
  Sequence:
  PWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 43 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for WDR77 Antibody - BSA Free

• Androgen receptor cofactor p44
• MEP-50
• MEP50Nbla10071
• methylosome protein 50
• MGC2722
• p44
• p44/Mep50
• RP11-552M11.3
• WD repeat domain 77
• WD repeat-containing protein 77

Background

WDR77 is a component of the 20S PRMT5 (MIM 604045)-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins (see MIM 601061). This modification targets Sm proteins to the survival of motor neurons (SMN) complex (see MIM 600354) for assembly into small nuclear ribonucleoprotein core particles (Friesen et al., 2002 [PubMed 11756452]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.