WDR74 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

WDR74 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WDR74.
  
  

  Source: E. coli

  Amino Acid Sequence: RNDWLDLRVPIWDQDIQFLPGSQKLVTCTGYHQVRVYDPASPQRRPVLETTYGEYPLTAMTLTPGGNSVIVGNTHGQLAEID

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: WDR74
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38411.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for WDR74 Recombinant Protein Antigen

• FLJ10439
• FLJ21730
• NOP seven-associated protein 1
• NSA1
• WD repeat domain 74
• WD repeat-containing protein 74

Background

WDR74, also known as WD repeat-containing protein 74, has a 385 amino acid long isoform that is 42 kDa and a short 366 amino acid isoform that is approx. 40 kDa, is located in the nucleolus and known to be required for RNA transcription, processing and/or stability during pre-implantation development and blastocyst formation in mouse. It is associated with Jervell and Lange-Nielsen syndrome, Jacobsen syndrome and Niemann-Pick disease. This protein has also shown to have an interaction with RGS2, CALR and NUDT3 in blastocyst formation, biological and RNA metabolic processes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: WDR74