WDR6 Antibody - BSA Free

Western Blot: WDR6 Antibody [NBP1-54844] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml

Immunohistochemistry: WDR6 Antibody [NBP1-54844] - Paraffin Embedded Tissue: Human Lung Cellular Data: Alveolar cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X

Immunohistochemistry: WDR6 Antibody [NBP1-54844] - Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

WDR6 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to WDR6 (WD repeat domain 6) The peptide sequence was selected from the C terminal of WDR6. Peptide sequence TPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WDR6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 53 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for WDR6 Antibody - BSA Free

• FLJ10218
• FLJ52552
• FLJ56107
• MGC126756
• MGC142027
• WD repeat domain 6
• WD repeat-containing protein 6

Background

WDR6 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WDR6
• Uniprot:
  • Q6AZD6(Human)