WDR44 Recombinant Protein Antigen

Images

 
There are currently no images for WDR44 Protein (NBP1-85048PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

WDR44 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WDR44.

Source: E. coli

Amino Acid Sequence: MRMKYNTEGRVSPSPSQESLSSSKSDTDTGVCSGTDEDPDDKNAPFRQRPFCKYKGHTADLLDLSWSKNYFLLSSSMDKTVR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
WDR44
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85048.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for WDR44 Recombinant Protein Antigen

  • DKFZp686L20145
  • FLJ13230
  • MGC26781
  • RAB11BP
  • rabphilin-11
  • RPH11
  • WD repeat domain 44
  • WD repeat-containing protein 44

Background

WDR44 is a member of the WD repeat family. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation. WD-repeat domain 44 (WDR44) was originally identified as rabphilin-11, a protein isolated from bovine brain extracts and cloned from a rat brain cDNA library. Rabphilin-11 was found to bind GTP-Rab11 and proposed to localize to the Golgi and recycling endosomes suggesting a role in vesicle recycling. WDR44 contains seven WD (tryptophan-aspartate) repeat domains found in a number of proteins that function as adaptor molecules in signal transduction and cytoskeletal organization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49320
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
2914-HT
Species: Hu
Applications: BA
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-80886
Species: Hu
Applications: IHC,  IHC-P
NBP1-33291
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP1-76309
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-61435
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-76802
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-97503
Species: Bv, Ca, Ch, Gp, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt, Sh, Xp
Applications: IHC,  IHC-P, IP, WB
6514-SL
Species: Hu
Applications: BA
MAB3629
Species: Mu
Applications: IHC
645-WN
Species: Hu, Mu
Applications: BA
NBP1-80903
Species: Hu
Applications: IHC,  IHC-P

Publications for WDR44 Protein (NBP1-85048PEP) (0)

There are no publications for WDR44 Protein (NBP1-85048PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR44 Protein (NBP1-85048PEP) (0)

There are no reviews for WDR44 Protein (NBP1-85048PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for WDR44 Protein (NBP1-85048PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WDR44 Products

Blogs on WDR44

There are no specific blogs for WDR44, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our WDR44 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR44