WDPCP Antibody - BSA Free

Western Blot: WDPCP Antibody [NBP1-58008] - Human Placenta lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

WDPCP Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to LOC51057(hypothetical protein LOC51057) The peptide sequence was selected from the N terminal of LOC51057. Peptide sequence LAQNKLCFIQFTKKMESSDVNKRLEKLSALDYKIFYYEIPGPINKTTERH. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WDPCP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for WDPCP Antibody - BSA Free

• Bardet-Biedl syndrome 15 protein
• BBS15C2orf86FRITZ
• chromosome 2 open reading frame 86
• DKFZp686C12204
• fritz
• FRTZ
• hFrtz
• WD repeat containing planar cell polarity effector
• WD repeat-containing and planar cell polarity effector protein
• WD repeat-containing protein C2orf86

Background

The specific function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WDPCP
• Uniprot:
  • O95876-2(Human)