WASF1/WAVE1 Recombinant Protein Antigen

Images

 
There are currently no images for WASF1/WAVE1 Protein (NBP1-83018PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

WASF1/WAVE1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WASF1.

Source: E. coli

Amino Acid Sequence: PRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCISSATGLIENRPQSPATGRTPVFVSPTP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
WASF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83018.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for WASF1/WAVE1 Recombinant Protein Antigen

  • KIAA0269WAVEhomology of dictyostelium scar 1
  • Protein WAVE-1
  • SCAR1
  • SCAR1WASP family protein member 1
  • Verprolin homology domain-containing protein 1
  • WAS protein family, member 1
  • WASF1
  • WASP1
  • WAVE1
  • WAVE1FLJ31482
  • wisk

Background

WASP (for Wiskott-Aldrich syndrome protein), N-WASP are downstream effectors of Cdc42 that are implicated in actin polymerization and cytoskeletal organization. The WASP family also includes VASP (vasodilator-stimulated phosphoprotein) and Mena (for mammalian enabled protein), which accumulate at focal adhesions and are also involved in the regulation of the actin cytoskeleton. The WAVE proteins are related to the WASP family proteins and are likewise involved in mediating actin reorganization downstream of the Rho family of small GTPases. The two protein homologs WAVE1 and WAVE2 specifically regulate membrane ruffling by inducing the formation of actin filament clusters in response to GTP binding and activating Rac. The WAVE proteins mediate this actin polymerization by cooperating with the Arp2/3 complex, a nucleation core, and thereby promoting the formation of actin filaments. WAVE1, which is also designated SCAR (for suppressor of cAR), is expressed primarily in the brain, while WAVE2 is widely expressed with the expression highest in peripheral blood leukocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
H00010097-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
AF1444
Species: Mu
Applications: IHC, WB
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-37912
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-46656
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-82512
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP3-16424
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-19491
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, WB
AF5515
Species: Hu, Mu
Applications: WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NB100-59845
Species: Hu
Applications: IHC,  IHC-P, IP (-), WB
H00051531-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
NBP3-03514
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NB110-68133
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-16060
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-88391
Species: Hu
Applications: ICC/IF, WB
NBP1-81162
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB

Publications for WASF1/WAVE1 Protein (NBP1-83018PEP) (0)

There are no publications for WASF1/WAVE1 Protein (NBP1-83018PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WASF1/WAVE1 Protein (NBP1-83018PEP) (0)

There are no reviews for WASF1/WAVE1 Protein (NBP1-83018PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for WASF1/WAVE1 Protein (NBP1-83018PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WASF1/WAVE1 Products

Research Areas for WASF1/WAVE1 Protein (NBP1-83018PEP)

Find related products by research area.

Blogs on WASF1/WAVE1

There are no specific blogs for WASF1/WAVE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Rac1 Antibody
NB100-91266

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our WASF1/WAVE1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol WASF1