VWA7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C6orf27 Antibody [NBP2-56840] - Staining of human cell line HeLa shows localization to plasma membrane & cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VWA7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LVFSVDGLLQKITVRIHGDISSFWIKNPAGVSQGQEEGGGPLGHTRRFGQFWMVTMDDPPQTGTWEIQVTAEDTPGVRVQAQTSLDFLFHFGIPMEDGPHPGLYPLTQPVAG
Specificity
Specificity of human C6orf27 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VWA7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VWA7 Recombinant Protein Antigen (NBP2-56840PEP)

Reactivity Notes

Mouse 84%, Rat 83%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for VWA7 Antibody

  • Chromosome 6 Open Reading Frame 27
  • G7C
  • NG37
  • Protein G7c
  • Von Willebrand Factor A Domain Containing 7
  • Von Willebrand Factor A Domain-Containing Protein 7
  • VWA7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13513
Species: Hu
Applications: WB, AG, ICC/IF, IHC, IHC-P, KD
NBP2-49627
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-44643
Species: Hu
Applications: Flow, ICC/IF, CyTOF-ready
38750002
Species: Ce
Applications: ELISA, ICC/IF, IHC
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-86019
Species: Hu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
NB100-61060
Species: Hu, Mu, V-Vi
Applications: WB, ChIP, IP
NBP1-57504
Species: Hu
Applications: WB, IHC, IHC-P
MAB3468
Species: Hu
Applications: WB, ICC
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-13893
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58095
Species: Hu
Applications: WB
MAB1599
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), KO, ELISA(Sta)
AF7895
Species: Hu
Applications: WB, IHC

Publications for VWA7 Antibody (NBP2-56840) (0)

There are no publications for VWA7 Antibody (NBP2-56840).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VWA7 Antibody (NBP2-56840) (0)

There are no reviews for VWA7 Antibody (NBP2-56840). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for VWA7 Antibody (NBP2-56840) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional VWA7 Products

Array NBP2-56840

Bioinformatics Tool for VWA7 Antibody (NBP2-56840)

Discover related pathways, diseases and genes to VWA7 Antibody (NBP2-56840). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on VWA7

There are no specific blogs for VWA7, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VWA7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VWA7