VWA2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VWA2. Source: E. coli
Amino Acid Sequence: VNPDVTQVGLVVYGSQVQTAFGLDTKPTRAAMLRAISQAPYLGGVGSAGTALLHIYDKVMTVQRGARPGVPKAVVVLTGGRGAEDAAVPAQKLRNNGISV Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
VWA2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89108. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for VWA2 Recombinant Protein Antigen
Background
Chimera RNA interference (chimera RNAi) is process by which small interfering RNA/DNA chimera triggers the destruction of mRNA for the original gene. The discovery work, design, and application of chimera RNAi has been pioneered by Professor Kaoru Saigo and Dr. Kumiko Ui-Tei at the University of Tokyo. Chimera RNAi has many advantages over the conventional siRNAs. First, it has been demonstrated to have reliable knock-down for over 10,000 human genes. Because the human genome is composed of an intricate, genetic network, chimera RNAi's unique design has successfully obviated the off-target effects including microRNA-based influence. Another advantage of the chimera RNAi technology is its effectiveness at low concentrations (0.5nM to 5nM); only mRNA is destroyed so genomic genes are not affected. Finally, having both the sense and anti-sense strands consisting RNA/DNA chimera, it offers much greater compound stability for streamlining in vitro and in vivo assays and applications while minimizing interferon induction and other adverse reactions.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: AC
Publications for VWA2 Recombinant Protein Antigen (NBP1-89108PEP) (0)
There are no publications for VWA2 Recombinant Protein Antigen (NBP1-89108PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VWA2 Recombinant Protein Antigen (NBP1-89108PEP) (0)
There are no reviews for VWA2 Recombinant Protein Antigen (NBP1-89108PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for VWA2 Recombinant Protein Antigen (NBP1-89108PEP) (0)
Additional VWA2 Products
Blogs on VWA2