Home » VPS37C » VPS37C Proteins » VPS37C Recombinant Protein Antigen

VPS37C Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for VPS37C Protein (NBP1-83632PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

VPS37C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VPS37C.

Source: E.coli

Amino Acid Sequence: KIEEESEAMAEKFLEGEVPLETFLENFSSMRMLSHLRRVRVEKLQEVVRKPRASQELAGD
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VPS37C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83632.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for VPS37C Recombinant Protein Antigen

  • ESCRT-I complex subunit VPS37C
  • FLJ20847
  • hVps37C
  • PML39
  • vacuolar protein sorting 37 homolog C (S. cerevisiae)
  • vacuolar protein sorting 37C (yeast)
  • vacuolar protein sorting 37C
  • vacuolar protein sorting-associated protein 37C

Background

VPS37C is a subunit of ESCRT-I (endosomal sorting complex required for transport I), a complex in the class E vacuolar protein sorting (VPS) pathway required for sorting ubiquitinated transmembrane proteins into internal vesicles of multivesicular bodies (Eastman et al., 2005).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TSG101 Antibody
(4A10)
NB200-112
Western Blot: TSG101 Antibody (4A10) [NB200-112] - Lane 1: MWM, Lane 2: TSG101 in RAW 264.7 Whole Cell Lysate, Lane 3: Exosome Lysate. Used primary antibody at 1:500 and Donkey Anti-Mouse at 0.5 ug/mL (this could be titrated down to reduce background). Used picogram sensitivity ECL reagents. Image from verified customer review.
Flow Cytometry: TSG101 Antibody (4A10) [NB200-112] - An intracellular stain was performed on HeLa cells with TSG101 Antibody (4A10) NB200-112F (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to FITC.
Flow Cytometry: TSG101 Antibody (4A10) [NB200-112] - An intracellular stain was performed on Hek293 cells with TSG101 Antibody [4A10] NB200-112PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
(2 Reviews)
(89 Publications)
Species: Ca, Ha, Hu, Pm, Mu, Po, Pm, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, IP, KD, WB
HGS Antibody (6D11)
H00009146-M01
Immunocytochemistry/Immunofluorescence: HGS Antibody (6D11) [H00009146-M01] - Analysis of monoclonal antibody to HGS on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: HGS Antibody (6D11) [H00009146-M01] - Analysis of HGS over-expressed 293 cell line, cotransfected with HGS Validated Chimera RNAi ( Cat # H00009146-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HGS monoclonal antibody (M01), clone 6D11 (Cat # H00009146-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Sandwich ELISA: HGS Antibody (6D11) [H00009146-M01] - Detection limit for recombinant GST tagged HGS is approximately 0.03ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, KD, S-ELISA, WB
VPS37A Antibody
NBP1-83528
Immunocytochemistry/Immunofluorescence: VPS37A Antibody [NBP1-83528] - Staining of human cell line U-251 MG shows localization to cytosol, centrosome and vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: VPS37A Antibody [NBP1-83528] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: VPS37A Antibody [NBP1-83528] - Staining of human prostate shows weak to moderate cytoplasmic positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
VPS4A Antibody
NBP1-54618
Western Blot: VPS4A Antibody [NBP1-54618] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: VPS4A Antibody [NBP1-54618] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle
Species: Hu
Applications: WB
VPS28 Antibody
(OTI1A8)
NBP2-45412
Immunofluorescence: VPS28 Antibody (OTI1A8) [NBP2-45412] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY VPS28.
Immunohistochemistry: VPS28 Antibody (OTI1A8) [NBP2-45412] - Analysis of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Western Blot: VPS28 Antibody (OTI1A8) [NBP2-45412] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY VPS28.
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IF, IHC, WB
TBK1 Antibody
(108A429) - BSA Free
NB100-56705
Immunohistochemistry-Paraffin: TBK1 Antibody (108A429) [NB100-56705] - Analysis of FFPE human testis tissue section using Peripheral Node Addressin antibody (clone MECA-79R) at 1:200. The staining was developed with HRP-DAB detection method and the counterstaining was performed using hematoxylin.
Immunocytochemistry/Immunofluorescence: TBK1 Antibody (108A429) [NB100-56705] - Antibody was tested in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red). A dilution of 1:10 was used. Image objective 40x.
Simple Western: TBK1 Antibody (108A429) [NB100-56705] - Lane view shows a specific band for NAK/TBK1 in 0.5 mg/ml of Daudi (left) and Raw 264.7 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody
(2 Reviews)
(29 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
EGFR Antibody
[Unconjugated]
AF231
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(15 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
UBAP1 Antibody
NBP1-80651
Immunocytochemistry/Immunofluorescence: UBAP1 Antibody [NBP1-80651] - Staining of human cell line A-431 shows localization to plasma membrane, cytosol & the Golgi apparatus.
Western Blot: UBAP1 Antibody [NBP1-80651] - Analysis of UBAP1 in Panc-1 and AsPC-1 whole cell lysates using anti-UBAP1 antibody. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: UBAP1 Antibody [NBP1-80651] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ATN1 Antibody
NBP1-90044
Immunocytochemistry/Immunofluorescence: ATN1 Antibody [NBP1-90044] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATN1 Antibody [NBP1-90044] - Analysis in human cerebral cortex and liver tissues. Corresponding ATN1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ATN1 Antibody [NBP1-90044] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
VPS37B Antibody
NBP1-82283
Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-VPS37B antibody NBP1-82283 (A) shows similar protein distribution across tissues to independent antibody NBP2-38398 (B).
Western Blot: VPS37B Antibody [NBP1-82283] - Analysis using Anti-VPS37B antibody NBP1-82283 (A) shows similar pattern to independent antibody NBP2-38398 (B).
Immunohistochemistry-Paraffin: VPS37B Antibody [NBP1-82283] - Staining of human fallopian tube shows strong positivity in apical membrane and moderate cytoplasmic staining in glandular cells.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(668 Publications)
Species: Hu
Applications: BA
HARS Antibody
NBP1-89490
Immunocytochemistry/Immunofluorescence: HARS Antibody [NBP1-89490] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: HARS Antibody [NBP1-89490] - Staining of human skin shows positivity in epidermal cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
SFRS5 Antibody
H00006430-B01P
Immunohistochemistry: SFRS5 Antibody [H00006430-B01P] - Representative images from immune-histochemical staining of Ac-SRSF5, SRSF5, and Smurf1 in three serial sections of the same tumor and matched adjacent tissue. Scale bar, 50um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41467-018-04815-3), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: SFRS5 Antibody [H00006430-B01P] - Analysis of purified antibody to SFRS5 on HeLa cell. (antibody concentration 10 ug/ml)
Immunohistochemistry-Paraffin: SFRS5 Antibody [H00006430-B01P] - Analysis of purified antibody to SFRS5 on formalin-fixed paraffin-embedded human ovary. (antibody concentration 1.5 ug/ml)
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
VPS25 Antibody
NBP3-06483
Western Blot: VPS25 Antibody [NBP3-06483] - Lane A: HL60 Whole Cell LysateLane B: THP-1 Whole Cell LysateLysates/proteins at 30 ug per lane.SecondaryGoat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution.Developed using the ECL technique.Performed under reducing conditions.Predicted band size:21 kDaObserved band size:21 kDa(We are unsure as to the identity of these extra bands.)
Immunohistochemistry-Paraffin: VPS25 Antibody [NBP3-06483] - Staining of human VPS25 in human kidney with rabbit polyclonal antibody at 1:100 dilution.
Immunoprecipitation: VPS25 Antibody [NBP3-06483] - Lane A:0.5 mg THP-1 Whole Cell Lysate4 uL anti-VPS25 rabbit polyclonal antibody and 60 ug of Immunomagnetic beads Protein A/G.Primary antibody:Anti-VPS25 rabbit polyclonal antibody,at 1:100 dilution Secondary antibody:Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilutionDeveloped using the ECL technique.Performed under reducing conditions.Predicted band size: 21 kDaObserved band size :21 kDa
Species: Hu
Applications: IHC, IHC-P, IP, WB
PTPN23 Antibody
H00025930-B01P
Western Blot: PTPN23 Antibody [H00025930-B01P] - Analysis of PTPN23 expression in transfected 293T cell line by PTPN23 polyclonal antibody. Lane 1: PTPN23 transfected lysate(63.47 KDa). Lane 2: Non-transfected lysate.
(2 Publications)
Species: Hu
Applications: ICC/IF, WB
ALDH9A1 Antibody
NBP1-89150
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in human cell line TD47D.
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in rat cell line NBT-II.
Immunohistochemistry-Paraffin: ALDH9A1 Antibody [NBP1-89150] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
(3 Publications)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
CHMP6 Antibody
NBP1-83726
Western Blot: CHMP6 Antibody [NBP1-83726] - Analysis in control (vector only transfected HEK293T lysate) and CHMP6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: CHMP6 Antibody [NBP1-83726] - Staining of human appendix shows cytoplasmic positivity in germinal center.
Species: Hu
Applications: IHC, IHC-P, WB
FAM125A Antibody
NBP1-91882
Immunohistochemistry-Paraffin: FAM125A Antibody [NBP1-91882] - Staining of human Heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: FAM125A Antibody [NBP1-91882] - Staining of human Skin shows strong membranous and cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: FAM125A Antibody [NBP1-91882] - Staining of human Urinary bladder shows moderate cytoplasmic positivity in urothelial cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Alix Antibody
NBP1-90201
Western Blot: Alix Antibody [NBP1-90201] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PDCD6IP antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: Alix Antibody [NBP1-90201] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Alix Antibody [NBP1-90201] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
(1 Review)
(10 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
IFN-alpha 1
Antibody
NBP2-75930
Western Blot: IFN-alpha 1 Antibody [NBP2-75930] - analysis of IFNA1 on mouse liver tissue lysate using anti-IFNA1 antibody at 1/100 dilution.
Immunocytochemistry/Immunofluorescence: IFN-alpha 1 Antibody [NBP2-75930] - staining IFNA1 in N2A cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: IFN-alpha 1 Antibody [NBP2-75930] - staining IFNA1 in SHG-44 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for VPS37C Protein (NBP1-83632PEP) (0)

There are no publications for VPS37C Protein (NBP1-83632PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS37C Protein (NBP1-83632PEP) (0)

There are no reviews for VPS37C Protein (NBP1-83632PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VPS37C Protein (NBP1-83632PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VPS37C Products

Array NBP1-83632PEP

Bioinformatics Tool for VPS37C Protein (NBP1-83632PEP)

Discover related pathways, diseases and genes to VPS37C Protein (NBP1-83632PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS37C Protein (NBP1-83632PEP)

Discover more about diseases related to VPS37C Protein (NBP1-83632PEP).
 

Pathways for VPS37C Protein (NBP1-83632PEP)

View related products by pathway.

PTMs for VPS37C Protein (NBP1-83632PEP)

Learn more about PTMs related to VPS37C Protein (NBP1-83632PEP).

Blogs on VPS37C

There are no specific blogs for VPS37C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western Blot: TSG101 Antibody (4A10) [NB200-112] - Lane 1: MWM, Lane 2: TSG101 in RAW 264.7 Whole Cell Lysate, Lane 3: Exosome Lysate. Used primary antibody at 1:500 and Donkey Anti-Mouse at 0.5 ug/mL (this could be titrated down to reduce background). Used picogram sensitivity ECL reagents. Image from verified customer review.
TSG101 Antibody (4A10)
NB200-112
Immunohistochemistry-Paraffin: TBK1 Antibody (108A429) [NB100-56705] - Analysis of FFPE human testis tissue section using Peripheral Node Addressin antibody (clone MECA-79R) at 1:200. The staining was developed with HRP-DAB detection method and the counterstaining was performed using hematoxylin.
TBK1 Antibody (108A429) - BSA Free
NB100-56705

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VPS37C Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol VPS37C