Recombinant Human VPS37A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human VPS37A Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 397 of Human VPS37A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTINNLTININILLPPQFPQEKPVISVYPPIRHHLMDKQGVYVTSPLVNNFTMHSDLGKIIQSLLDEFWKNPPVLAPTSTAFPYLYSNPSGMSPYASQGFPFLPPYPPQEANRSITSLSVADTVSSSTTSHTTAKPAAPSFGVLSNLPLPIPTVDASIPTSQNGFGYKMPDVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDKYELLTQMKSTFEKKMQRQHELSEICSASALQARLKVAAHEAEEESDNIAEDFLEGKMEIDDFLSSFMEKRTICHCRRAKEEKLQQAIAMHSQFHAPL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
VPS37A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human VPS37A Protein

  • ESCRT-I complex subunit VPS37A
  • FLJ32642
  • HCRP1FLJ42616
  • hepatocellular carcinoma related protein 1
  • Hepatocellular carcinoma-related protein 1
  • hVps37A
  • polyglutamine binding protein 2
  • PQBP2
  • vacuolar protein sorting 37 homolog A (S. cerevisiae)
  • vacuolar protein sorting 37A (yeast)
  • vacuolar protein sorting 37A
  • vacuolar protein sorting-associated protein 37A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85976
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83632
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP1-82283
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47485
Species: Hu
Applications: WB, IHC, IHC-P
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
NBP1-80651
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89391
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84158
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91882
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for VPS37A Recombinant Protein (H00137492-P01) (0)

There are no publications for VPS37A Recombinant Protein (H00137492-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS37A Recombinant Protein (H00137492-P01) (0)

There are no reviews for VPS37A Recombinant Protein (H00137492-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPS37A Recombinant Protein (H00137492-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VPS37A Products

Bioinformatics Tool for VPS37A Recombinant Protein (H00137492-P01)

Discover related pathways, diseases and genes to VPS37A Recombinant Protein (H00137492-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS37A Recombinant Protein (H00137492-P01)

Discover more about diseases related to VPS37A Recombinant Protein (H00137492-P01).
 

Pathways for VPS37A Recombinant Protein (H00137492-P01)

View related products by pathway.

PTMs for VPS37A Recombinant Protein (H00137492-P01)

Learn more about PTMs related to VPS37A Recombinant Protein (H00137492-P01).

Blogs on VPS37A

There are no specific blogs for VPS37A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

VPS37A Antibody
NBP1-83528

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VPS37A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS37A