VPS29 Antibody

Images

 
Western Blot: VPS29 Antibody [NBP1-85288] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-VPS29 antibody. Remaining relative intensity is presented. Loading ...read more
Immunocytochemistry/ Immunofluorescence: VPS29 Antibody [NBP1-85288] - Staining of human cell line U-251 MG shows positivity in cytoplasm and vesicles.
Immunohistochemistry-Paraffin: VPS29 Antibody [NBP1-85288] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.
Western Blot: VPS29 Antibody [NBP1-85288] - Analysis in human cell line A-549.
Simple Western: VPS29 Antibody [NBP1-85288] - Simple Western lane view shows a specific band for VPS29 in 0.2 mg/ml of RT-4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Signal Stimulation: VPS29 Antibody [NBP1-85288] - Electropherogram image of the corresponding Simple Western lane view. VPS29 antibody was used at 1:5 dilution on RT-4 lysate(s) respectively.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, SignalStim
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VPS29 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AGHRLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VPS29
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Simple Western 1:5
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
  • Signal Stimulation
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
Control Peptide
VPS29 Protein (NBP1-85288PEP)
Publications
Read Publications using NBP1-85288.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VPS29 Antibody

  • DC15
  • DC7
  • DKFZp564F0223
  • EC 3.1.3.3
  • FLJ20492
  • hVPS29
  • PEP11 homolog
  • PEP11
  • retromer protein
  • vacuolar protein sorting 29 (yeast homolog)
  • vacuolar protein sorting 29 (yeast)
  • vacuolar protein sorting 29 homolog (S. cerevisiae)
  • vacuolar protein sorting-associated protein 29
  • vacuolar sorting protein VPS29/PEP11
  • Vesicle protein sorting 29
  • x 007 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36754
Species: Hu
Applications: WB, IB, ICC/IF, IHC
NB100-1397
Species: Hu, Mu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA, ICC
NB100-282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89485
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3926
Species: Hu, Mu, Rt
Applications: WB
NBP1-92575
Species: Hu
Applications: IHC, IHC-P
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-82972
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
NBP2-13361
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44235
Species: Ce, Pl
Applications: WB, ELISA, IHC
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20471
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1362
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for VPS29 Antibody (NBP1-85288)(2)

Reviews for VPS29 Antibody (NBP1-85288) (0)

There are no reviews for VPS29 Antibody (NBP1-85288). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VPS29 Antibody (NBP1-85288) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VPS29 Products

Bioinformatics Tool for VPS29 Antibody (NBP1-85288)

Discover related pathways, diseases and genes to VPS29 Antibody (NBP1-85288). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS29 Antibody (NBP1-85288)

Discover more about diseases related to VPS29 Antibody (NBP1-85288).
 

Pathways for VPS29 Antibody (NBP1-85288)

View related products by pathway.

PTMs for VPS29 Antibody (NBP1-85288)

Learn more about PTMs related to VPS29 Antibody (NBP1-85288).
 

Research Areas for VPS29 Antibody (NBP1-85288)

Find related products by research area.

Blogs on VPS29

There are no specific blogs for VPS29, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS29 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS29