VP26B Antibody

Images

 
Immunohistochemistry-Paraffin: VP26B Antibody [NBP1-92575] - Staining of human small intestine shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: VP26B Antibody [NBP1-92575] - Staining of human cerebellum shows moderate cytoplasmic positivity in cells in granular layer.
Immunohistochemistry-Paraffin: VP26B Antibody [NBP1-92575] - Staining of human placenta shows weak cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: VP26B Antibody [NBP1-92575] - Staining of human prostate shows weak membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VP26B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RRYFKQQEVVLWRKGDIVRKSMSHQAAIASQRFEGTTSLGEVRTPSQLSDNNCRQ
Specificity
Specificity of human VP26B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VPS26B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VP26B Recombinant Protein Antigen (NBP1-92575PEP)
Publications
Read Publications using
NBP1-92575 in the following applications:

  • KO
    1 publication
  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (Qureshi YH et al).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VP26B Antibody

  • MGC10485
  • Pep8b
  • vacuolar protein sorting 26 homolog B (S. pombe)
  • vacuolar protein sorting 26 homolog B (yeast)
  • vacuolar protein sorting-associated protein 26B
  • Vesicle protein sorting 26B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75922
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-41109
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NB100-1397
Species: Hu, Mu, Ca, Ch, ChHa
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF1029
Species: Mu
Applications: WB, IHC, IP, ICC
AF8216
Species: Hu, Mu, Rt
Applications: WB
NBP2-33286
Species: Hu
Applications: IHC, IHC-P
AF5320
Species: Hu
Applications: WB
NBP2-75515
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5699
Species: Hu, Mu
Applications: WB, IHC
NBP2-38237
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-809
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
AF2934
Species: Mu
Applications: WB, Simple Western, IHC, Block
NBP2-24513
Species: Hu, Mu, Bv, Ca, Eq, Ma-Op, Pm, RM
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-75670
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92575
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for VP26B Antibody (NBP1-92575)(3)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: KO, WB.


Filter By Application
KO
(1)
WB
(2)
All Applications
Filter By Species
Mouse
(2)
All Species
Showing Publications 1 - 3 of 3.
Publications using NBP1-92575 Applications Species
Qureshi YH, Berman DE, Klein RL, Patel VM et al. Retromer repletion with AAV9-VPS35 restores endosomal function in the mouse hippocampus bioRxiv May 15 2019 (WB, Mouse) WB Mouse
simoes s, Guo J, Buitrago L Alzheimer's Vulnerable Brain Region Relies on the VPS26b Retromer Core SSRN Journal Dec 12 2019
Christensen S, Narimatsu Y, Simoes S et al. Endosomal trafficking is required for glycosylation and normal maturation of the Alzheimers-associated protein sorLA bioRxiv Jul 14 2020 (WB, KO, Mouse) WB, KO Mouse

Reviews for VP26B Antibody (NBP1-92575) (0)

There are no reviews for VP26B Antibody (NBP1-92575). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for VP26B Antibody (NBP1-92575) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional VP26B Products

Bioinformatics Tool for VP26B Antibody (NBP1-92575)

Discover related pathways, diseases and genes to VP26B Antibody (NBP1-92575). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for VP26B Antibody (NBP1-92575)

View related products by pathway.

Blogs on VP26B

There are no specific blogs for VP26B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VP26B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS26B