VPS13B Antibody - Azide and BSA Free

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

VPS13B Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VPS13B (NP_060360.3). MLESYVTPILMSYVNRYIKNLKPSDLQLSLWGGDVVLSKLELKLDVLEQELKLPFTFLSGHIHELRIHVPWTKLGSEPVVITINTMECILKLKDGIQDDH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VPS13B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for VPS13B Antibody - Azide and BSA Free

• cohen syndrome protein 1
• DKFZp313I0811
• KIAA0532
• vacuolar protein sorting 13 homolog B (yeast)

Background

The VPS13B gene encodes a potential transmembrane protein that may function in vesicle-mediated transport and sorting ofproteins within the cell. This protein may play a role in the development and the function of the eye, hematologicalsystem, and central nervo

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: VPS13B