Recombinant Human VMAT2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human VMAT2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 53-151 of Human VMAT2

Source: Wheat Germ

Amino Acid Sequence: HEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC18A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human VMAT2 Protein

  • MGC120477
  • MNAT
  • monoamine neurotransmitter transporter
  • Monoamine transporter
  • SLC18A2
  • solute carrier family 18 (vesicular monoamine), member 2
  • Solute carrier family 18 member 2
  • SVAT
  • SVMT
  • SVMTMGC120478
  • synaptic vesicular amine transporter
  • VAT2
  • VAT2MGC26538
  • vesicle monoamine transporter type 2
  • vesicle monoamine/H+ antiporter
  • Vesicular amine transporter 2
  • VMAT2

Background

SLC18A2 - solute carrier family 18 (vesicular monoamine), member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP2-55798
Species: Hu
Applications: IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
NB100-91348
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-174
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2156
Species: Hu, Mu
Applications: WB, IHC
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-20857
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for VMAT2 Partial Recombinant Protein (H00006571-Q01) (0)

There are no publications for VMAT2 Partial Recombinant Protein (H00006571-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VMAT2 Partial Recombinant Protein (H00006571-Q01) (0)

There are no reviews for VMAT2 Partial Recombinant Protein (H00006571-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VMAT2 Partial Recombinant Protein (H00006571-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VMAT2 Products

Bioinformatics Tool for VMAT2 Partial Recombinant Protein (H00006571-Q01)

Discover related pathways, diseases and genes to VMAT2 Partial Recombinant Protein (H00006571-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VMAT2 Partial Recombinant Protein (H00006571-Q01)

Discover more about diseases related to VMAT2 Partial Recombinant Protein (H00006571-Q01).
 

Pathways for VMAT2 Partial Recombinant Protein (H00006571-Q01)

View related products by pathway.

PTMs for VMAT2 Partial Recombinant Protein (H00006571-Q01)

Learn more about PTMs related to VMAT2 Partial Recombinant Protein (H00006571-Q01).

Blogs on VMAT2

There are no specific blogs for VMAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

VMAT2 Antibody
NBP1-69750-0.1ml

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VMAT2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC18A2
Entrez