VMA21 Antibody

Images

 
Immunohistochemistry-Paraffin: VMA21 Antibody [NBP1-82783] - Staining of human testis shows strong cytoplasmic positivity in leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VMA21 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PRRTMLRGKSRLNVEWLGYSPGLLLEHRPLLAGRTPRSHRR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VMA21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VMA21 Protein (NBP1-82783PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VMA21 Antibody

  • MEAXMGC131652
  • MGC125514
  • Myopathy with excessive autophagy protein
  • myopathy with excessive autophagy
  • vacuolar ATPase assembly integral membrane protein VMA21
  • VMA21 vacuolar H+-ATPase homolog (S. cerevisiae)
  • XMEAMGC125516

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-07836
Species: Hu
NBP2-22217
Species: Hu, Mu, Rt(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
MAB3694
Species: Hu
Applications: WB, IHC
NBP1-81621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00028299-P01
Species: Hu
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP1-91979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56121
Species: Hu
Applications: ICC/IF, IHC-P
NB100-137
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-37371
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89881
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46556
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS

Publications for VMA21 Antibody (NBP1-82783) (0)

There are no publications for VMA21 Antibody (NBP1-82783).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VMA21 Antibody (NBP1-82783) (0)

There are no reviews for VMA21 Antibody (NBP1-82783). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for VMA21 Antibody (NBP1-82783) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VMA21 Products

Bioinformatics Tool for VMA21 Antibody (NBP1-82783)

Discover related pathways, diseases and genes to VMA21 Antibody (NBP1-82783). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VMA21 Antibody (NBP1-82783)

Discover more about diseases related to VMA21 Antibody (NBP1-82783).
 

Pathways for VMA21 Antibody (NBP1-82783)

View related products by pathway.

PTMs for VMA21 Antibody (NBP1-82783)

Learn more about PTMs related to VMA21 Antibody (NBP1-82783).

Blogs on VMA21

There are no specific blogs for VMA21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VMA21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VMA21