VKORC1 Antibody - BSA Free

Western Blot: VKORC1 Antibody [NBP2-83750] - WB Suggested Anti-VKORC1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Brain

Immunohistochemistry-Paraffin: VKORC1 Antibody [NBP2-83750] - Rabbit Anti-VKORC1 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:100. Other Working Concentrations: N/A. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20X. Exposure Time: 0.5 - 2.0 sec

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

VKORC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit VKORC1 Antibody - BSA Free (NBP2-83750) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of VKORC1. Peptide sequence: LHVKAARARDRDYRALCDVGTAISCSRVFSSRLPADTLGLCPDAAELPGV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VKORC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for VKORC1 Antibody - BSA Free

• EC 1.1.4.1
• EDTP308
• FLJ00289
• IMAGE3455200
• MST576
• phylloquinone epoxide reductase
• vitamin K dependent clMST134
• vitamin K epoxide reductase complex subunit 1
• vitamin K epoxide reductase complex, subunit 1
• Vitamin K1 2,3-epoxide reductase subunit 1
• vitamin K1 epoxide reductase (warfarin-sensitive)
• VKCFD2
• VKORMGC2694

Background

Vitamin K is essential for blood clotting but must be enzymatically activated. This enzymatically activated form of vitamin K is a reduced form required for the carboxylation of glutamic acid residues in some blood-clotting proteins. The product of this gene encodes the enzyme that is responsible for reducing vitamin K 2,3-epoxide to the enzymatically activated form. Fatal bleeding can be caused by vitamin K deficiency and by the vitamin K antagonist warfarin, and it is the product of this gene that is sensitive to warfarin. In humans, mutations in this gene can be associated with deficiencies in vitamin-K-dependent clotting factors and, in humans and rats, with warfarin resistance. Two pseudogenes have been identified on chromosome 1 and the X chromosome. Two alternatively spliced transcripts encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VKORC1