visinin-like 1 Antibody (0R1V3)

Western Blot: visinin-like 1 Antibody (0R1V3) [NBP3-33331] - Western blot analysis of various lysates using visinin-like 1 Rabbit mAb at1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Western Blot: visinin-like 1 Antibody (0R1V3) [NBP3-33331] - Western blot analysis of various lysates using visinin-like 1 Rabbit mAb at1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 0R1V3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

visinin-like 1 Antibody (0R1V3) Summary

• Description: Novus Biologicals Rabbit visinin-like 1 Antibody (0R1V3) (NBP3-33331) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2-191 of human visinin-like 1 (NP_003376.2).
  
  Sequence:
  GKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: VSNL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for visinin-like 1 Antibody (0R1V3)

• HLP3Hippocalcin-like protein 3
• HPCAL3
• HUVISL1
• VILIP
• VILIP-1
• VILIPVLP-1
• visinin-like 1
• visinin-like protein 1
• VISL1
• VSNL1

Background

visinin-like 1 is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intracellular signaling pathways of the central nervous system by directly or indirectly regulating the activity of adenylyl cyclase. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VSNL1