VIGR/GPR126 Antibody

Images

 
Immunohistochemistry-Paraffin: VIGR/GPR126 Antibody [NBP1-89859] - Staining of human smooth muscle shows distinct cytoplasmic positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VIGR/GPR126 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KRSLEDEPRLVLWALLVYNATNNTNLEGKIIQQKLLKNNESLDEGLRLHTVNVRQLGHCLAMEEPKGYYWPSIQPSEYVLPCPDKPGFSASRICFYNATNPLVTYWGPVD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR126
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VIGR/GPR126 Recombinant Protein Antigen (NBP1-89859PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VIGR/GPR126 Antibody

  • APG1
  • Developmentally regulated G-protein-coupled receptor
  • DREG
  • FLJ14937
  • G protein-coupled receptor 126
  • Gm222
  • GPR126
  • G-protein coupled receptor 126
  • HBV PreS1-transactivated protein 2
  • PS1TP2
  • Vascular inducible G protein-coupled receptor
  • vascular-inducible G protein-coupled receptor
  • VIGR
  • VIGRPS1TP2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
NBP2-52419
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-58020
Species: Hu
Applications: ICC/IF
AF4634
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-24738
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-03561
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
AF2864
Species: Hu
Applications: WB, ICC

Publications for VIGR/GPR126 Antibody (NBP1-89859) (0)

There are no publications for VIGR/GPR126 Antibody (NBP1-89859).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VIGR/GPR126 Antibody (NBP1-89859) (0)

There are no reviews for VIGR/GPR126 Antibody (NBP1-89859). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for VIGR/GPR126 Antibody (NBP1-89859) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VIGR/GPR126 Products

Bioinformatics Tool for VIGR/GPR126 Antibody (NBP1-89859)

Discover related pathways, diseases and genes to VIGR/GPR126 Antibody (NBP1-89859). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VIGR/GPR126 Antibody (NBP1-89859)

Discover more about diseases related to VIGR/GPR126 Antibody (NBP1-89859).
 

Pathways for VIGR/GPR126 Antibody (NBP1-89859)

View related products by pathway.

PTMs for VIGR/GPR126 Antibody (NBP1-89859)

Learn more about PTMs related to VIGR/GPR126 Antibody (NBP1-89859).
 

Research Areas for VIGR/GPR126 Antibody (NBP1-89859)

Find related products by research area.

Blogs on VIGR/GPR126

There are no specific blogs for VIGR/GPR126, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VIGR/GPR126 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR126
Entrez