Home » VGLL4 » VGLL4 Antibodies » VGLL4 Antibody

VGLL4 Antibody

 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: VGLL4 Antibody [NBP2-38421] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Genetic Strategies: Western Blot: VGLL4 Antibody [NBP2-38421] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. ...read more
Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] - Positive staining can be observed in the nuclears of gastric epithelial cells. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] - Staining of human prostate shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

VGLL4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EEHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMVSHSHS
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VGLL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. VGLL4 antibody validated for IHC from a verified customer review.
Control Peptide
VGLL4 Recombinant Protein Antigen (NBP2-38421PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-38421 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VGLL4 Antibody

  • KIAA0121transcription cofactor vestigial-like protein 4
  • vestigial like 4 (Drosophila)
  • Vestigial-like 4
  • VGL-4

Background

VGLL4 may act as a specific coactivator for the mammalian TEFs

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

VGLL1 Antibody
NBP2-31921
Immunohistochemistry-Paraffin: VGLL1 Antibody [NBP2-31921] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: VGLL1 Antibody [NBP2-31921] - Staining in human placenta and skeletal muscle tissues.. Corresponding VGLL1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: VGLL1 Antibody [NBP2-31921] - Staining of human liver shows no positivity in hepatocytes as expected.
Species: Hu
Applications: IHC, IHC-P
TEF1 Antibody
NBP2-94035
Chromatin Immunoprecipitation: TEF1 Antibody [NBP2-94035] - Analysis of extracts of HeLa cell line, using TEF1 rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Immunocytochemistry/Immunofluorescence: TEF1 Antibody [NBP2-94035] - Analysis of MCF7 cells using TEF1 .
Western Blot: TEF1 Antibody [NBP2-94035] - Analysis of extracts of various cell lines, using TEAD1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 180s.
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
XIAP Antibody
[Unconjugated]
AF8221
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, C2C12 mouse myoblast cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat XIAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8221) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for XIAP at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and C2C12 mouse myoblast cell line, loaded at 0.2 mg/mL. A specific band was detected for XIAP at approximately 59 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat XIAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8221) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and XIAP knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat XIAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8221) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for XIAP at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockoutHeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(15 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
TRAF-2 Antibody
NB100-56173
Immunocytochemistry/Immunofluorescence: TRAF-2 Antibody [NB100-56173] - Immunostaining of HN30 and MCF-12a cells for TRAF2 3 days post-transfectionMCF-12a NT (DAPI): non-treated MCF-12a DAPI stained, MCF-12a NT (TRAF2-FITC): non-treated MCF-12a FITC stained for TRAF2, MCF-12a pNSP 5a3a (DAPI): MCF-12a transfected with pcDNA 3.0 NSP 5a3a DAPI stained, MCF-12a pNSP 5a3a (TRAF2-FITC): MCF-12a transfected with pcDNA 3.0 NSP 5a3a FITC stained for Traf-2, HN30 NT (DAPI): non-treated HN30 DAPI stained, HN30 NT (TRAF2-FITC): non-treated HN30 FITC stained for TRAF2, HN30 pNSP 5a3a (DAPI): HN30 transfected with pcDNA 3.0 NSP 5a3a DAPI stained, HN30 pNSP 5a3a (TRAF2-FITC): HN30 transfected with pcDNA 3.0 NSP 5a3a FITC stained for TRAF2. White arrows indicate apoptotic bodies. Image collected and cropped by Citeab from the following publication (A novel dual signaling axis for NSP 5a3a induced apoptosis in head and neck carcinoma. Oncotarget (2011) licensed under a CC-BY licence.
Immunohistochemistry: TRAF-2 Antibody [NB100-56173] - Formalin-fixed, paraffin-embedded human melanoma tissue section stained for TRAF2 at 1:2000. A1 is a higher magnification of A. Hematoxylin-eosin counterstain.
Immunohistochemistry-Paraffin: TRAF-2 Antibody [NB100-56173] - Formalin-fixed, paraffin-embedded human colon carcinoma tissue sections stained for TRAF2 using this antibody at 1:2000. Hematoxylin-eosin counterstain.
(3 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Recombinant Human
VGLL2 GST (N-Term) Pr ...
H00245806-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
(2 Reviews)
Species: Hu
Applications: ELISA, AP, PA, WB
TANK Antibody
NB100-56144
Immunohistochemistry: TANK Antibody - Unpurified [NB100-56144] - TANK Antibody [NB100-56144] - Immunohistochemical analysis of TANK/I-TRAF1 expression in formalin-fixed, paraffin-embedded normal human colon using this antibody at 1:2000. A-A3, low and high magnification images. Hematoxylin-eosin counterstain.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
cIAP-2/HIAP-1
Antibody - BSA Free
NBP1-27972
Immunocytochemistry/Immunofluorescence: cIAP-2/HIAP-1 Antibody [NBP1-27972] - HIAD1 staining in Hela cells detected with a Dylight 488 labeled secondary antibody (Green) with Hoechst 33258 nuclear counterstain (Blue).
Simple Western: cIAP-2/HIAP-1 Antibody [NBP1-27972] - Simple Western lane view shows a specific band for Ciap2 in 0.5 mg/ml of HepG2 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system. *Non-specific interaction with the 230 kDa standard may be seen with this antibody.
Immunohistochemistry: cIAP-2/HIAP-1 Antibody [NBP1-27972] - Analysis of human adenocarcinoma cells and adjacent glands using anti-cIAP2.
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
MAGT1 Antibody
NBP2-14214
Immunohistochemistry-Paraffin: MAGT1 Antibody [NBP2-14214] - Staining of human thyroid gland shows moderate to strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: MAGT1 Antibody [NBP2-14214] - Staining of human cervix, uterine shows moderate membranous/cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: MAGT1 Antibody [NBP2-14214] - Staining of human endometrium shows moderate to strong membranous positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
cIAP-1/HIAP-2
Antibody [Unconjugate
AF8181
Western blot shows lysates of HEK293 human embryonic kidney cell line transfected with human cIAP-1 (lane 1), human cIAP-2 (lane 2), or non-transfected (lane 3). PVDF membrane was probed with 0.5 µg/mL Goat Anti-Human cIAP‑1/HIAP‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8181) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). For additional reference, lystates of HepG2 human hepatocellular carcinoma cell line and Jurkat human acute T cell leukemia cell line were included. A specific band for cIAP‑1/HIAP‑2 was detected at approximately 65 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
cIAP‑1/HIAP‑2 was detected in immersion fixed paraffin-embedded sections of human lymph node using Goat Anti-HumancIAP‑1/HIAP‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8181) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and cIAP-1/HIAP-2 knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human cIAP‑1/HIAP‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8181) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for cIAP‑1/HIAP‑2 at approximately 68 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(4 Reviews)
(42 Publications)
Species: Hu
Applications: IHC, KO, Simple Western, WB
Amylin Antibody
NBP2-33680
Immunohistochemistry: Amylin Antibody [NBP2-33680] - Staining of human pancreas shows distinct cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Amylin Antibody [NBP2-33680] - Staining in human pancreas and skeletal muscle tissues . Corresponding IAPP RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Alkaline
Phosphatase, Intestin ...
H00000248-M03
Western Blot: Alkaline Phosphatase, Intestinal Antibody (3A8) [H00000248-M03] - Analysis of ALPI expression in HeLa (Cat # L013V1).
ELISA: Alkaline Phosphatase, Intestinal Antibody (3A8) [H00000248-M03] - Detection limit for recombinant GST tagged ALPI is 0.3 ng/ml as a capture antibody.
(5 Publications)
Species: Hu
Applications: ELISA, WB
CD47 Antibody
(B6H12.2) - Azide and ...
NBP2-31106
Immunocytochemistry: CD47 Antibody (B6H12.2) - Azide Free [NBP2-31106] - Human trabecular meshwork (primary ocular cells). Image from verified customer review.
Western Blot: CD47 Antibody (B6H12.2) - Azide Free [NBP2-31106] - Detection of CD47 expression on two hematological cancer cell lines, Jurkat and Raji. WB image submitted by a verified customer review.
Flow Cytometry: CD47 Antibody (B6H12.2) - Azide Free [NBP2-31106] - A surface stain was performed on A431 cells with CD47 Antibody [B6H12.2] NBP2-31106PCP (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 5 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to PerCP.
(3 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow-CS, Flow, ICC, ICC/IF, IHC, IHC-P, IP, WB
VEGF [HRP]
DVE00
(621 Publications)
Species: Hu
Applications: ELISA
CDIPT Antibody
NBP2-49233
Immunocytochemistry/Immunofluorescence: CDIPT Antibody [NBP2-49233] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm, nuclear membrane & plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CDIPT Antibody [NBP2-49233] - Staining of human cerebellum shows strong granular cytoplasmic positivity in purkinje cells.
Immunohistochemistry-Paraffin: CDIPT Antibody [NBP2-49233] - Staining of human testis shows moderate granular cytoplasmic positivity in Leydig cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MLL3 Antibody
NBP2-57730
Immunocytochemistry/Immunofluorescence: MLL3 Antibody [NBP2-57730] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF
IRF2BP2 Antibody
NBP1-93674
Immunocytochemistry/Immunofluorescence: IRF2BP2 Antibody [NBP1-93674] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.
Western Blot: IRF2BP2 Antibody [NBP1-93674] - Analysis in human cell line THP-1.
Immunohistochemistry-Paraffin: IRF2BP2 Antibody [NBP1-93674] - Staining of human endometrium shows moderate nuclear positivity in glandular cells
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
EIF3A Antibody
NBP2-24570
Western Blot: EIF3A Antibody [NBP2-24570] - analysis of eIF3A in Daudi lysate in the 1) absence and 2) presence of immunizing peptide and 3) NIH 3T3 lysate using eIF3A antibody at 0.5 ug/ml, 0.5 ug/ml and 0.25 ug/ml respectively.
Immunohistochemistry-Paraffin: EIF3A Antibody [NBP2-24570] - Formalin-fixed, paraffin-embedded human brain tissue stained with eIF3A antibody at 10 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Simple Western: EIF3A Antibody [NBP2-24570] - Simple Western lane view shows a specific band for EIF3A in 0.5 mg/ml of NIH-3T3 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB
p120-catenin
Antibody (OTI2E8)
NBP2-45646
Immunohistochemistry: p120-catenin Antibody (2E8) [NBP2-45646] - Analysis of Carcinoma of Human kidney tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: p120-catenin Antibody (2E8) [NBP2-45646] - Analysis of Carcinoma of Human prostate tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: p120-catenin Antibody (2E8) [NBP2-45646] - Analysis of Human colon tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
ANKRD2 Antibody
NBP1-91670
Immunocytochemistry/Immunofluorescence: ANKRD2 Antibody [NBP1-91670] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ANKRD2 Antibody [NBP1-91670] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: ANKRD2 Antibody [NBP1-91670] - Staining in human skeletal muscle and prostate tissues using anti-ANKRD2 antibody. Corresponding ANKRD2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
VGLL4 Antibody
NBP2-38421
VGLL4 Antibody
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD

Publications for VGLL4 Antibody (NBP2-38421) (0)

There are no publications for VGLL4 Antibody (NBP2-38421).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for VGLL4 Antibody (NBP2-38421) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-38421:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin VGLL4 NBP2-38421
Enlarge 		5
reviewed by:
Feng Li
 IHC-P Human 09/22/2017
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedStomach tissue
SpeciesHuman
LotLotA106714

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VGLL4 Antibody (NBP2-38421) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VGLL4 Products

Bioinformatics Tool for VGLL4 Antibody (NBP2-38421)

Discover related pathways, diseases and genes to VGLL4 Antibody (NBP2-38421). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VGLL4 Antibody (NBP2-38421)

Discover more about diseases related to VGLL4 Antibody (NBP2-38421).
 

Pathways for VGLL4 Antibody (NBP2-38421)

View related products by pathway.

Blogs on VGLL4

There are no specific blogs for VGLL4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Immunohistochemistry-Paraffin VGLL4 NBP2-38421
Enlarge
 Feng Li
09/22/2017
Application: IHC-P
Species: Human
read this review

Bioinformatics

Gene Symbol VGLL4
Uniprot