![Western Blot: VGLL4 Antibody [NBP2-38421] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/VGLL4-Antibody-Western-Blot-NBP2-38421-img0005.jpg "Western Blot: VGLL4 Antibody [NBP2-38421] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EEHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMVSHSHS |
| Predicted Species | Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | VGLL4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IHC-P | Human | 09/22/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] - Positive staining can be observed in the nuclears of gastric epithelial cells. Image submitted by a verified customer review.](http://images.novusbio.com/fullsize/VGLL4-Antibody-Immunohistochemistry-Paraffin-NBP2-38421-img0004.jpg "Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] - Positive staining can be observed in the nuclears of gastric epithelial cells. Image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] - Staining of human prostate shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/VGLL4-Antibody-Immunohistochemistry-Paraffin-NBP2-38421-img0003.jpg "Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] - Staining of human prostate shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] -Staining of human endometrium shows weak nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp2-38421_rabbit-polyclonal-vgll4-antibody-immunohistochemistry-paraffin-2862023103210..jpg "Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] -Staining of human endometrium shows weak nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] -Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/antibody/nbp2-38421_rabbit-polyclonal-vgll4-antibody-immunohistochemistry-paraffin-2862023103318..jpg "Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] -Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] -Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/antibody/nbp2-38421_rabbit-polyclonal-vgll4-antibody-immunohistochemistry-paraffin-2862023103422..jpg "Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP2-38421] -Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot XIAP Antibody [Unconjugated]](https://images.novusbio.com/images2/XIAP_AF8221_Western_Blot_5911.jpg)
![Simple Western XIAP Antibody [Unconjugated]](https://images.novusbio.com/images2/XIAP_AF8221_Simple_Western_16640.jpg)
![Knockout Validated XIAP Antibody [Unconjugated]](https://images.novusbio.com/images2/XIAP_AF8221_Knockout_Validated_22488.jpg)
![Western Blot cIAP-2/HIAP-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/cIAP-2_AF8171_Western_Blot_5906.jpg)
![Simple Western cIAP-2/HIAP-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/cIAP2_AF8171_Simple_Western_16646.jpg)
![Immunohistochemistry cIAP-2/HIAP-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/cIAP-2_AF8171_Immunohistochemistry_6903.jpg)
![Western Blot cIAP-1/HIAP-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/cIAP-1_AF8181_Western_Blot_5907.jpg)
![Immunohistochemistry cIAP-1/HIAP-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/cIAP1_AF8181_Immunohistochemistry_17211.jpg)
![Knockout Validated cIAP-1/HIAP-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/cIAP1_AF8181_Knockout_Validated_22291.jpg)
![Western Blot CD47 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD47_AF4670_Western_Blot_15788.jpg)
![Neutralization CD47 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD47_AF4670_Block_Neutralize_11560.jpg)
![Immunohistochemistry CD47 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD47_AF4670_Immunohistochemistry_6841.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
