VGLL4 Antibody

Images

 
Western Blot: VGLL4 Antibody [NBP1-81543] - Analysis of 293T cell lysates. VGL4 band at about 37 kDa. VGL4 (green), GAPDH (red). IHC Image submitted by a verified customer review.
Immunocytochemistry/ Immunofluorescence: VGLL4 Antibody [NBP1-81543] - Staining of human cell line U-2 OS shows localization to nucleus and nucleoli fibrillar center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP1-81543] - Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.
Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP1-81543] - Staining of human endometrium shows moderate to strong positivity in glandular cells.
Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP1-81543] - Staining of human fallopian tube shows moderate positivity in glandular cells.
Immunohistochemistry-Paraffin: VGLL4 Antibody [NBP1-81543] - Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VGLL4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PISPSKRKFSMEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VGLL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. VGLL4 antibody validated for WB from a verified customer review.
Reviewed Applications
Read 1 Review rated 5
using
NBP1-81543 in the following applications:

Publications
Read Publication using NBP1-81543.

Reactivity Notes

Mouse (88%), Rat (86%). Reactivity reported in scientific literature (PMID: 23435261).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VGLL4 Antibody

  • KIAA0121transcription cofactor vestigial-like protein 4
  • vestigial like 4 (Drosophila)
  • Vestigial-like 4
  • VGL-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31921
Species: Hu
Applications: IHC, IHC-P
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NB100-56173
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
H00245806-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-56144
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-27972
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-14214
Species: Hu
Applications: IHC, IHC-P
AF8181
Species: Hu
Applications: IHC, KO, Simple Western, WB
NBP2-33680
Species: Hu
Applications: IHC, IHC-P
H00000248-M03
Species: Hu
Applications: ELISA, WB
NBP2-31106
Species: Hu, Mu
Applications: CyTOF-ready, Flow-CS, Flow, ICC, ICC/IF, IHC, IHC-P, IP, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-49233
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57730
Species: Hu
Applications: ICC/IF
NBP1-93674
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24570
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-91670
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81543
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for VGLL4 Antibody (NBP1-81543)(1)

Review for VGLL4 Antibody (NBP1-81543) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-81543:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot VGLL4 NBP1-81543
Enlarge
5
reviewed by:
Feng Li
WB Human 01/30/2019
View

Summary

ApplicationWestern Blot
Sample Tested293T lysates
SpeciesHuman
LotE114757

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VGLL4 Antibody (NBP1-81543) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VGLL4 Products

Bioinformatics Tool for VGLL4 Antibody (NBP1-81543)

Discover related pathways, diseases and genes to VGLL4 Antibody (NBP1-81543). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VGLL4 Antibody (NBP1-81543)

Discover more about diseases related to VGLL4 Antibody (NBP1-81543).
 

Pathways for VGLL4 Antibody (NBP1-81543)

View related products by pathway.

Blogs on VGLL4

There are no specific blogs for VGLL4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Feng Li
01/30/2019
Application: WB
Species: Human

Bioinformatics

Gene Symbol VGLL4