VGLL4 Antibody - BSA Free

Western Blot: VGLL4 Antibody [NBP1-81543] - Analysis of 293T cell lysates. VGL4 band at about 37 kDa. VGL4 (green), GAPDH (red).WB Image submitted by a verified customer review.

Immunocytochemistry/Immunofluorescence: VGLL4 Antibody [NBP1-81543] - Staining of human cell line U-2 OS shows localization to nucleus and nucleoli fibrillar center. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

VGLL4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit VGLL4 Antibody - BSA Free (NBP1-81543) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-VGLL4 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PISPSKRKFSMEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VGLL4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot Validated from a verified customer review
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse (88%), Rat (86%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for VGLL4 Antibody - BSA Free

• KIAA0121transcription cofactor vestigial-like protein 4
• vestigial like 4 (Drosophila)
• Vestigial-like 4
• VGL-4

Background

VGLL4 may act as a specific coactivator for the mammalian TEFs

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for VGLL4 Antibody (NBP1-81543)(2)

Publications using NBP1-81543

• Li F, Liu R, Negi V et al. VGLL4 and MENIN function as TEAD1 corepressors to block pancreatic ? cell proliferation Cell Reports 2023-01-31 [PMID: 36662616]
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Review for VGLL4 Antibody (NBP1-81543) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 01/30/2019

Summary

• Application: Western Blot
• Sample Tested: 293T lysates
• Species: Human
• Lot: E114757

Bioinformatics

• Gene Symbol: VGLL4