VGLL1 Antibody (3C7)

Images

 
Western Blot: VGLL1 Antibody (3C7) [H00051442-M01] - Analysis of VGLL1 expression in transfected 293T cell line by VGLL1 monoclonal antibody (M01), clone 3C7.Lane 1: VGLL1 transfected lysate(28.7 KDa).Lane 2: ...read more
Sandwich ELISA: VGLL1 Antibody (3C7) [H00051442-M01] - Detection limit for recombinant GST tagged VGLL1 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

VGLL1 Antibody (3C7) Summary

Immunogen
VGLL1 (NP_057351.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEEMKKTAIRLPKGKQKPIKTEWNSRCVLFTYFQGDISSVVDEHFSRALSNIKSPQELTPSSQSEGVMLKNDDSMSPNQWRYSSPWTKPQPEVPVTNRAA
Specificity
VGLL1 - vestigial like 1 (Drosophila) (3C7)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
VGLL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VGLL1 Antibody (3C7)

  • Protein TONDU
  • TDUtranscription cofactor vestigial-like protein 1
  • TONDU
  • vestigial like 1 (Drosophila)
  • VGL1
  • vgl-1
  • WUGSC:H_GS188P18.1b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP1-81543
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00245806-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB110-58359
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, PLA, Simple Western, WB
NB110-58358
Species: Ca, Hu, Mu, Rt, Ze
Applications: ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NBP1-85896
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-687
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-80461
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-31590
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-04382
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00007004-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, KD, WB
NBP2-84300
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81763
Species: Hu
Applications: IHC, IHC-P, WB
NB100-2814
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA, WB
H00051442-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for VGLL1 Antibody (H00051442-M01) (0)

There are no publications for VGLL1 Antibody (H00051442-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VGLL1 Antibody (H00051442-M01) (0)

There are no reviews for VGLL1 Antibody (H00051442-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VGLL1 Antibody (H00051442-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VGLL1 Products

Bioinformatics Tool for VGLL1 Antibody (H00051442-M01)

Discover related pathways, diseases and genes to VGLL1 Antibody (H00051442-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VGLL1 Antibody (H00051442-M01)

Discover more about diseases related to VGLL1 Antibody (H00051442-M01).
 

Pathways for VGLL1 Antibody (H00051442-M01)

View related products by pathway.

Blogs on VGLL1

There are no specific blogs for VGLL1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VGLL1 Antibody (3C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol VGLL1
Entrez
Uniprot