Home » VENTX » VENTX Antibodies » VENTX Antibody

VENTX Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: VENTX Antibody [H00027287-B01P] - Analysis of VENTX expression in transfected 293T cell line by VENTX polyclonal antibody. Lane 1: VENTX transfected lysate(28.38 KDa). Lane 2: Non-transfected lysate.
Western Blot: VENTX Antibody [H00027287-B01P] - Analysis of VENTX expression in transfected 293T cell line by VENTX polyclonal antibody. Lane 1: VENTX transfected lysate(28.38 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: VENTX Antibody [H00027287-B01P] - Analysis of purified antibody to VENTX on HepG2 cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

VENTX Antibody Summary

Immunogen
VENTX (NP_055283.1, 1 a.a. - 258 a.a.) full-length human protein. MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF
Specificity
VENTX - VENT homeobox homolog (Xenopus laevis),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
VENTX
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It has also been used for immunofluorescence.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VENTX Antibody

  • homeobox protein VENTX
  • HPX42BNA88A
  • MGC119910
  • MGC119911
  • VENT homeobox homolog (Xenopus laevis)
  • VENT homeobox homolog
  • VENT-like homeobox 2
  • VENT-like homeobox protein 2
  • VENTX2hemopoietic progenitor homeobox protein VENTX2

Background

This gene encodes a member of the Vent family of homeodomain proteins. The encoded protein may function as a transcriptional repressor and be involved in mesodermal patterning and hemopoietic stem cell maintenance. Multiple pseudogenes exist for this gene. A transcribed pseudogene located on chromosome X may lead to antigen production in certain melanomas. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - CD8 alpha expression in mouse spleen tissue using anti-CD8 alpha antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of bone marrow tissue by single and multiple staining.
Immunohistochemistry-Frozen: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of mosue spleen sections. CD8+ lymphocytes are marked by brown labeling of the cell surface.
(3 Reviews)
(20 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
IL-3 [Unconjugated]
203-IL/CF
1 μg/lane of Recombinant Human IL-3 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.
Recombinant Human IL-3 (Catalog #203‑IL/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 0.02‑0.1 ng/mL.
(185 Publications)
Species: Hu
Applications: BA
TBP like protein
TLP Antibody
NBP2-49671
Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP2-49671] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP2-49671] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP2-49671] - Staining in human testis and liver tissues using anti-TBPL1 antibody. Corresponding TBPL1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
HLA B Antibody
(2G7B10) - BSA Free
NBP2-61871
ELISA: HLA B Antibody (2G7B10) [NBP2-61871] - Black line: Control Antigen (100 ng);Purple line: Antigen (10ng); Blue line: Antigen (50 ng); Red line:Antigen (100 ng)
Flow Cytometry: HLA B Antibody (2G7B10) [NBP2-61871] - Analysis of MCF-7 cells using HLA-B mouse mAb (green) and negative control (red).
Immunocytochemistry/Immunofluorescence: HLA B Antibody (2G7B10) [NBP2-61871] - Analysis of Hela cells using HLA-B mouse mAb. Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
TYRP1 Antibody
NBP1-88370
Western Blot: TYRP1 Antibody [NBP1-88370] - Analysis in control (vector only transfected HEK293T lysate) and TYRP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Analysis in human skin and cerebral cortex tissues. Corresponding TYRP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Staining of human endometrium shows no positivity in glandular cells as expected.
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
CD38 Antibody
(1G7F4) - BSA Free
NBP2-25250
Immunohistochemistry-Frozen: CD38 Antibody (1G7F4) [NBP2-25250] - B cell lymphoma tumor sections (Ramos). Antibody Dilution 1:200. IHC-Fr image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: CD38 Antibody (1G7F4) [NBP2-25250] - HuH-7 cells (human liver cancer cell line) stained with Alexa Fluor 647 conjugated CD38 antibody. Image using the Alexa Fluor 647 format of this antibody. ICC/IF image submitted by a verified customer review.
Western Blot: CD38 Antibody (1G7F4) [NBP2-25250] - Analysis of (A) Human Jurkat, (B) Human Ramos and (C) Mouse EL4 lysate using this antibody at 4 ug/mL.
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Siglec-3/CD33
[Unconjugated]
1137-SL
Siglec-3/CD33 [Unconjugated]
(7 Publications)
Species: Hu
Applications: BA
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(46 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
GM-CSF
[Unconjugated]
7954-GM/CF
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 6-30 pg/mL.
(2 Publications)
Species: Hu
Applications: BA
CD34 Antibody (MEC
14.7)
NB600-1071
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - An intracellular stain was performed on Raw264.7 cells with CD34 Antibody [MEC 14.7] NB600-1071 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rat IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 488 (SA5-10018, Thermo Fisher).
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 (MEC 14.7) antibody was tested at 1:250 in WEHI-3 cells with DyLight 488 (green) alongside a matched isotype control (black).
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(24 Publications)
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
GM-CSF
[Unconjugated]
7954-GM/CF
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 6-30 pg/mL.
(2 Publications)
Species: Hu
Applications: BA
Goosecoid Antibody
(OTI1D7)
NBP1-47790
Flow Cytometry: Goosecoid Antibody (1D7) [NBP1-47790] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-GSC antibody, and then analyzed by flow cytometry.
Immunohistochemistry-Paraffin: Goosecoid Antibody (1D7) [NBP1-47790] - Staining of paraffin-embedded Carcinoma of Human kidney tissue using anti-GSC mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Goosecoid Antibody (1D7) [NBP1-47790] - Staining of paraffin-embedded Human Kidney tissue using anti-GSC mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Recombinant Human
Blood group H inhibit ...
H00002523-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
LEF1 Antibody (3H5)
H00051176-M01
Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - Analysis of LEF1 over-expressed 293 cell line, cotransfected with LEF1 Validated Chimera RNAi ( Cat # H00051176-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with LEF1 monoclonal antibody (M01), clone 3H5 (Cat # H00051176-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Sandwich ELISA: LEF1 Antibody (3H5) [H00051176-M01] - Detection limit for recombinant GST tagged LEF1 is approximately 0.3ng/ml as a capture antibody.
Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - LEF1 monoclonal antibody (M01), clone 3H5. Analysis of LEF1 expression in HL-60.
(3 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
Smad5 Antibody
AF2250
Smad5 was detected in immersion fixed paraffin-embedded sections of human colon using 5 µg/mL Human Smad5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2250) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: IHC, WB
ATN1 Antibody
NBP1-90044
Immunocytochemistry/Immunofluorescence: ATN1 Antibody [NBP1-90044] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATN1 Antibody [NBP1-90044] - Analysis in human cerebral cortex and liver tissues. Corresponding ATN1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ATN1 Antibody [NBP1-90044] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
BMP-4
[Unconjugated]
314-BP/CF
1 ug/lane of Recombinant Human BMP-4 was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 22-25 kDa and 37-41 kDa, respectively. Multiple bands in gel are due to variable glycosylation. 
Recombinant Human BMP-4 (Catalog #314-BP/CF) induces alkaline phosphatase production in the ATDC5 mouse chondrogenic cell line. The ED50 for this effect is 2.5-15 ng/mL.
(463 Publications)
Species: Hu
Applications: BA, BA
BMP-7
[Unconjugated]
354-BP/CF
Recombinant human BMP-7 (354-BP/CF) induces alkaline phosphatase production in the ATDC5 mouse chondrogenic cell line. The ED50 for this effect is 0.1-0.6 µg/mL.
(92 Publications)
Species: Hu
Applications: BA

Publications for VENTX Antibody (H00027287-B01P) (0)

There are no publications for VENTX Antibody (H00027287-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VENTX Antibody (H00027287-B01P) (0)

There are no reviews for VENTX Antibody (H00027287-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VENTX Antibody (H00027287-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VENTX Products

Bioinformatics Tool for VENTX Antibody (H00027287-B01P)

Discover related pathways, diseases and genes to VENTX Antibody (H00027287-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VENTX Antibody (H00027287-B01P)

Discover more about diseases related to VENTX Antibody (H00027287-B01P).
 

Pathways for VENTX Antibody (H00027287-B01P)

View related products by pathway.

Blogs on VENTX

There are no specific blogs for VENTX, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VENTX Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol VENTX
Entrez
Uniprot