VE-Statin/EGFL7 Recombinant Protein Antigen

Images

 
There are currently no images for VE-Statin/EGFL7 Recombinant Protein Antigen (NBP2-68693PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

VE-Statin/EGFL7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VE-Statin/EGFL7.

Source: E.coli

Amino Acid Sequence: RGDTCQSGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKD

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EGFL7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-68693. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VE-Statin/EGFL7 Recombinant Protein Antigen

  • EGFL7
  • EGF-like protein 7
  • EGF-like-domain, multiple 7
  • epidermal growth factor-like protein 7
  • MEGF7
  • MGC111117
  • Multiple EGF-like domains protein 7
  • Multiple epidermal growth factor-like domains protein 7
  • NEU1 protein
  • NOTCH4-like protein
  • RP11-251M1.2
  • Vascular endothelial statin
  • VEStatin
  • VE-Statin
  • ZNEU1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1049
Species: Hu
Applications: WB, IHC
21630002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-00783
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-32682
Species: Hu
Applications: IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Rb, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-92177
Species: Hu
Applications: IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-57964
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb, Ze
Applications: WB, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for VE-Statin/EGFL7 Recombinant Protein Antigen (NBP2-68693PEP) (0)

There are no publications for VE-Statin/EGFL7 Recombinant Protein Antigen (NBP2-68693PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VE-Statin/EGFL7 Recombinant Protein Antigen (NBP2-68693PEP) (0)

There are no reviews for VE-Statin/EGFL7 Recombinant Protein Antigen (NBP2-68693PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VE-Statin/EGFL7 Recombinant Protein Antigen (NBP2-68693PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional VE-Statin/EGFL7 Products

Bioinformatics Tool for VE-Statin/EGFL7 Recombinant Protein Antigen (NBP2-68693PEP)

Discover related pathways, diseases and genes to VE-Statin/EGFL7 Recombinant Protein Antigen (NBP2-68693PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VE-Statin/EGFL7 Recombinant Protein Antigen (NBP2-68693PEP)

Discover more about diseases related to VE-Statin/EGFL7 Recombinant Protein Antigen (NBP2-68693PEP).
 

Pathways for VE-Statin/EGFL7 Recombinant Protein Antigen (NBP2-68693PEP)

View related products by pathway.

PTMs for VE-Statin/EGFL7 Recombinant Protein Antigen (NBP2-68693PEP)

Learn more about PTMs related to VE-Statin/EGFL7 Recombinant Protein Antigen (NBP2-68693PEP).
 

Research Areas for VE-Statin/EGFL7 Recombinant Protein Antigen (NBP2-68693PEP)

Find related products by research area.

Blogs on VE-Statin/EGFL7

There are no specific blogs for VE-Statin/EGFL7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VE-Statin/EGFL7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EGFL7