We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

VDAC1 Recombinant Protein Antigen

Images

 
There are currently no images for VDAC1 Protein (NBP2-38163PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

VDAC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VDAC1.

Source: E. coli

Amino Acid Sequence: KWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VDAC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38163.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VDAC1 Recombinant Protein Antigen

  • hVDAC1
  • MGC111064
  • Outer mitochondrial membrane protein porin 1
  • Plasmalemmal porin
  • Porin 31HL
  • Porin 31HM
  • PORIN
  • PORIN-31-HL
  • VDAC
  • VDAC1
  • VDAC-1
  • voltage-dependent anion channel 1
  • voltage-dependent anion-selective channel protein 1

Background

VDAC1 is an outer membrane mitochondrial protein. The VDAC proteins are thought to form aqueous channels, or pores, through which adenine nucleotides cross the outer mitochondrial membrane. VDACs have been implicated in the formation of the mitochondrial permeability transition pore complex in apoptotic cells. This complex, formed by VDAC, adenine nucleotide translocator (ANT), and cyclophilin D (CypD), is thought to allow the mitochondria to undergo metabolic uncoupling and irreversible morphologic changes that ultimately destroy the mitochondria during apoptosis. VDACs are highly expressed in heart, liver and skeletal muscle, where concentrations of mitochondria are at their highest.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20849
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr,  IHC-P, WB
NBP2-94176
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB110-74751
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP3-05640
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-62583
Species: Hu
Applications: WB
NB100-41398
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP3-47902
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB100-74635
Species: Hu
Applications: IHC,  IHC-P, IP, WB (-)
NBP3-41307
Species: Bv, Hu
Applications: Flow, ICC/IF, IHC, WB
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: ICC/IF, IF, IHC,  IHC-P, MI, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF816
Species: Hu
Applications: ICC, IHC, WB
AF860
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP2-38163PEP
Species: Hu
Applications: AC

Publications for VDAC1 Protein (NBP2-38163PEP) (0)

There are no publications for VDAC1 Protein (NBP2-38163PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VDAC1 Protein (NBP2-38163PEP) (0)

There are no reviews for VDAC1 Protein (NBP2-38163PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VDAC1 Protein (NBP2-38163PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VDAC1 Products

Research Areas for VDAC1 Protein (NBP2-38163PEP)

Find related products by research area.

Blogs on VDAC1

There are no specific blogs for VDAC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VDAC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol VDAC1