Recombinant Human VDAC1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human VDAC1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 156-276 of Human VDAC1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
VDAC1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human VDAC1 Protein

  • hVDAC1
  • MGC111064
  • Outer mitochondrial membrane protein porin 1
  • Plasmalemmal porin
  • Porin 31HL
  • Porin 31HM
  • PORIN
  • PORIN-31-HL
  • VDAC
  • VDAC-1
  • voltage-dependent anion channel 1
  • voltage-dependent anion-selective channel protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-80070
Species: Hu
Applications: WB, IHC
NB110-74753
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP2-57614
Species: Hu
Applications: ICC/IF
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-59448
Species: Hu
Applications: WB
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
H00007416-Q03
Species: Hu
Applications: WB, ELISA, PA

Publications for VDAC1 Partial Recombinant Protein (H00007416-Q03) (0)

There are no publications for VDAC1 Partial Recombinant Protein (H00007416-Q03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VDAC1 Partial Recombinant Protein (H00007416-Q03) (0)

There are no reviews for VDAC1 Partial Recombinant Protein (H00007416-Q03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VDAC1 Partial Recombinant Protein (H00007416-Q03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VDAC1 Products

Bioinformatics Tool for VDAC1 Partial Recombinant Protein (H00007416-Q03)

Discover related pathways, diseases and genes to VDAC1 Partial Recombinant Protein (H00007416-Q03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VDAC1 Partial Recombinant Protein (H00007416-Q03)

Discover more about diseases related to VDAC1 Partial Recombinant Protein (H00007416-Q03).
 

Pathways for VDAC1 Partial Recombinant Protein (H00007416-Q03)

View related products by pathway.

PTMs for VDAC1 Partial Recombinant Protein (H00007416-Q03)

Learn more about PTMs related to VDAC1 Partial Recombinant Protein (H00007416-Q03).

Blogs on VDAC1

There are no specific blogs for VDAC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

VDAC1 Antibody
NB100-695
Bcl-2 Antibody
NB100-56098

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VDAC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VDAC1