Vasohibin Antibody - BSA Free

Western Blot: Vasohibin Antibody [NBP1-82944] - Analysis in control (vector only transfected HEK293T lysate) and VASH1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: Vasohibin Antibody [NBP1-82944] - Staining of human placenta shows cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Vasohibin Antibody [NBP1-82944] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: Vasohibin Antibody [NBP1-82944] - Staining of human testis shows moderate cytoplasmic-nuclear positivity in cells in seminiferous ducts and Leydig cells.

Immunohistochemistry-Paraffin: Vasohibin Antibody [NBP1-82944] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Vasohibin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Vasohibin Antibody - BSA Free (NBP1-82944) is a polyclonal antibody validated for use in IHC and WB. Anti-Vasohibin Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRCWHVLKKVKLGQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARDMRLKIGKGTGPPSPTKDRKKDVSSPQRAQSSPHRRNSRSERRPSGDKKTSEPKAMPD
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VASH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Vasohibin Recombinant Protein Antigen (NBP1-82944PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Vasohibin Antibody - BSA Free

• KIAA1036
• KIAA1036vasohibin-1
• VASH
• VASH1
• vasohibin 1
• Vasohibin

Background

"Angiogenesis inhibitor. Inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. Does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. Acts in an autocrine manner. Inhibits artery neointimal formation and macrophage

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Vasohibin Antibody (NBP1-82944)(1)

Publication using NBP1-82944

• Mulder J, Wernerus H, Shi TJ et al. Systematically generated antibodies against human gene products: high throughput screening on sections from the rat nervous system. Neuroscience 2007-06-08 [PMID: 17478047]

Bioinformatics

• Gene Symbol: VASH1