VAM1 Antibody

Images

 
Western Blot: VAM1 Antibody [NBP1-87365] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: VAM1 Antibody [NBP1-87365] - Staining in human testis and colon tissues using anti-MPP6 antibody. Corresponding MPP6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: VAM1 Antibody [NBP1-87365] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: VAM1 Antibody [NBP1-87365] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VAM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NEILEDITPLINVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNNSSINNQLLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARIL
Specificity
Specificity of human VAM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPP6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VAM1 Recombinant Protein Antigen (NBP1-87365PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VAM1 Antibody

  • MAGUK protein p55T
  • membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6)
  • p55T
  • protein associated with Lin7 2
  • VAM-1PALS2VAM1MAGUK p55 subfamily member 6
  • Veli-associated MAGUK 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-186
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF7979
Species: Hu, Mu, Rt
Applications: WB
NBP2-15016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-85014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
MAB3678
Species: Hu
Applications: WB, IHC
NBP1-85038
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-88088
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-53082
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-41181
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF
NBP1-87839
Species: Hu
Applications: IHC, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NB110-68135
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-88453
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46383
Species: Hu
Applications: WB, Flow, IHC
NBP1-87365
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for VAM1 Antibody (NBP1-87365) (0)

There are no publications for VAM1 Antibody (NBP1-87365).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VAM1 Antibody (NBP1-87365) (0)

There are no reviews for VAM1 Antibody (NBP1-87365). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VAM1 Antibody (NBP1-87365) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for VAM1 Antibody (NBP1-87365)

Discover related pathways, diseases and genes to VAM1 Antibody (NBP1-87365). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VAM1 Antibody (NBP1-87365)

Discover more about diseases related to VAM1 Antibody (NBP1-87365).
 

Pathways for VAM1 Antibody (NBP1-87365)

View related products by pathway.

PTMs for VAM1 Antibody (NBP1-87365)

Learn more about PTMs related to VAM1 Antibody (NBP1-87365).
 

Research Areas for VAM1 Antibody (NBP1-87365)

Find related products by research area.

Blogs on VAM1

There are no specific blogs for VAM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VAM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPP6