VABP Antibody

Images

 
Western Blot: VABP Antibody [NBP1-81560] - Analysis in control (vector only transfected HEK293T lysate) and KCNIP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: VABP Antibody [NBP1-81560] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VABP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLY
Specificity
Specificity of human VABP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VABP Protein (NBP1-81560PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VABP Antibody

  • A-type potassium channel modulatory protein 1
  • KChIP1
  • KCHIP1MGC95
  • Kv channel interacting protein 1
  • Kv channel-interacting protein 1
  • potassium channel interacting protein 1
  • Potassium channel-interacting protein 1
  • VABP
  • Vesicle APC-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP1-82864
Species: Hu
Applications: IHC, IHC-P
NBP2-30049
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
H00030819-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi
H00080333-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-81336
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-42819
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, IP, B/N
NBP1-88191
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-54705
Species: Hu
Applications: IHC, IHC-P
NBP2-47481
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88227
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89112
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-81560
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for VABP Antibody (NBP1-81560) (0)

There are no publications for VABP Antibody (NBP1-81560).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VABP Antibody (NBP1-81560) (0)

There are no reviews for VABP Antibody (NBP1-81560). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VABP Antibody (NBP1-81560) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for VABP Antibody (NBP1-81560)

Discover related pathways, diseases and genes to VABP Antibody (NBP1-81560). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VABP Antibody (NBP1-81560)

Discover more about diseases related to VABP Antibody (NBP1-81560).
 

Pathways for VABP Antibody (NBP1-81560)

View related products by pathway.

PTMs for VABP Antibody (NBP1-81560)

Learn more about PTMs related to VABP Antibody (NBP1-81560).

Blogs on VABP

There are no specific blogs for VABP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VABP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNIP1