V1a Vasopressin R/AVPR1A Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of V1a Vasopressin R/AVPR1A. Peptide sequence: PCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKF The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
AVPR1A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for V1a Vasopressin R/AVPR1A Antibody - BSA Free
Background
The protein encoded by the AVPR1A gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily ofG-protein coupled receptors which includes AVPR1B, V2R and OXT receptors. Its activity is mediated by G proteins whichstimulate a phosphatidylinositol-calcium second messenger system. The receptor mediates cell contraction andproliferation, platelet aggregation, release of coagulation factor and glycogenolysis. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
Species: Hu
Applications: Flow, IHC, IHC-P, PEP-ELISA
Species: Ha, Hu, Pm, Mu, Rb, Rt
Applications: IHC, IHC-Fr, IHC-P
Species: Bt, Bv, Ca, Eq, Hu, Po, Rb, Rt
Applications: ICC/IF (-), IHC, IHC-P, WB (-)
Species: Hu, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Publications for V1a Vasopressin R/AVPR1A Antibody (NBP2-84326) (0)
There are no publications for V1a Vasopressin R/AVPR1A Antibody (NBP2-84326).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for V1a Vasopressin R/AVPR1A Antibody (NBP2-84326) (0)
There are no reviews for V1a Vasopressin R/AVPR1A Antibody (NBP2-84326).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for V1a Vasopressin R/AVPR1A Antibody (NBP2-84326) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional V1a Vasopressin R/AVPR1A Products
Research Areas for V1a Vasopressin R/AVPR1A Antibody (NBP2-84326)
Find related products by research area.
|
Blogs on V1a Vasopressin R/AVPR1A