V1a Vasopressin R/AVPR1A Antibody


Western Blot: V1a Vasopressin R/AVPR1A Antibody [NBP2-84325] - WB Suggested Anti-AVPR1A Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole Cell

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

V1a Vasopressin R/AVPR1A Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of V1a Vasopressin R/AVPR1A. Peptide sequence: WIYMFFSGHLLQDCVQSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPT The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for V1a Vasopressin R/AVPR1A Antibody

  • Antidiuretic hormone receptor 1a
  • arginine vasopressin receptor 1A
  • AVPR V1a
  • AVPR1
  • AVPR1A
  • SCCL vasopressin subtype 1a receptor
  • V1a Vasopressin R
  • V1a vasopressin receptor
  • V1a VasopressinR
  • V1aR
  • V1-vascular vasopressin receptor AVPR1A
  • Vascular/hepatic-type arginine vasopressin receptor
  • vasopressin V1a receptor


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IM, IP, KD, WB
Species: Hu
Applications: Flow, IHC, IHC-P, PEP-ELISA
Applications: ELISA
Species: Ha, Hu, Pm, Mu, Rb, Rt
Applications: IHC, IHC-Fr, IHC-P
Species: Bt, Bv, Ca, Eq, Hu, Po, Rb, Rt
Applications: ICC/IF (-), IHC, IHC-P, WB (-)
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P

Publications for V1a Vasopressin R/AVPR1A Antibody (NBP2-84325) (0)

There are no publications for V1a Vasopressin R/AVPR1A Antibody (NBP2-84325).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for V1a Vasopressin R/AVPR1A Antibody (NBP2-84325) (0)

There are no reviews for V1a Vasopressin R/AVPR1A Antibody (NBP2-84325). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for V1a Vasopressin R/AVPR1A Antibody (NBP2-84325) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional V1a Vasopressin R/AVPR1A Products

Bioinformatics Tool for V1a Vasopressin R/AVPR1A Antibody (NBP2-84325)

Discover related pathways, diseases and genes to V1a Vasopressin R/AVPR1A Antibody (NBP2-84325). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for V1a Vasopressin R/AVPR1A Antibody (NBP2-84325)

Discover more about diseases related to V1a Vasopressin R/AVPR1A Antibody (NBP2-84325).

Pathways for V1a Vasopressin R/AVPR1A Antibody (NBP2-84325)

View related products by pathway.

Research Areas for V1a Vasopressin R/AVPR1A Antibody (NBP2-84325)

Find related products by research area.

Blogs on V1a Vasopressin R/AVPR1A

There are no specific blogs for V1a Vasopressin R/AVPR1A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our V1a Vasopressin R/AVPR1A Antibody and receive a gift card or discount.


Gene Symbol AVPR1A