Home » V1a Vasopressin R/AVPR1A » AVPR1A Antibodies » V1a Vasopressin R/AVPR1A Antibody

V1a Vasopressin R/AVPR1A Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: V1a Vasopressin R/AVPR1A Antibody [NBP2-84325] - WB Suggested Anti-AVPR1A Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole Cell
Western Blot: V1a Vasopressin R/AVPR1A Antibody [NBP2-84325] - WB Suggested Anti-AVPR1A Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

V1a Vasopressin R/AVPR1A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of V1a Vasopressin R/AVPR1A. Peptide sequence: WIYMFFSGHLLQDCVQSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPT The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
AVPR1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for V1a Vasopressin R/AVPR1A Antibody

  • Antidiuretic hormone receptor 1a
  • arginine vasopressin receptor 1A
  • AVPR V1a
  • AVPR1
  • AVPR1A
  • SCCL vasopressin subtype 1a receptor
  • V1a Vasopressin R
  • V1a vasopressin receptor
  • V1a VasopressinR
  • V1aR
  • V1-vascular vasopressin receptor AVPR1A
  • Vascular/hepatic-type arginine vasopressin receptor
  • vasopressin V1a receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Neurophysin
II/Arg-vasopressin An ...
AF009
Neurophysin II was detected in immersion fixed paraffin-embedded sections of human pituitary using Goat Anti-Human Neurophysin II Antigen Affinity-purified Polyclonal Antibody (Catalog # AF009) at 3 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell cytoplasm. Staining was performed using our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Species: Hu
Applications: IHC, WB
IFN-alpha/beta R1
Antibody [Unconjugate ...
AF245
IFN-alpha/beta R1 Antibody [Unconjugated]
(5 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
NLRP3/NALP3
Antibody - BSA Free
NBP2-12446
Western Blot: NLRP3/NALP3 Antibody [NBP2-12446] - Analysis in mouse cell lysate.
Western Blot: NLRP3/NALP3 Antibody [NBP2-12446] - Regular aerobic exercise decreased myocardial inflammation in HFD rats. Representative Western blot analysis of NLRP3 and caspase-1. Image collected and cropped by CiteAb from the following publication (https://www.frontiersin.org/article/10.3389/fphys.2019.01286/full), licensed under a CC-BY licence.
Western Blot: NLRP3/NALP3 Antibody [NBP2-12446] - C-AR inhibited NLRP3 inflammasome activation in synovial tissue. NLRP3 protein expression in succinate-stimulated synovial fibroblasts. The results were derived from four independent experiments for immunohistochemistry staining and Western blot and expressed as the mean +/- SD. *p < 0.05 vs. the model; #p < 0.05 vs. the indicated treatment. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fimmu.2016.00532/full), licensed under a CC-BY licence.
(4 Reviews)
(128 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IM, IP, KD, WB
OXTR Antibody
NBP2-76347
Flow Cytometry: OXTR Antibody [NBP2-76347] - Analysis of paraformaldehyde fixed Jurkat cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunohistochemistry-Paraffin: OXTR Antibody [NBP2-76347] - Staining of paraffin embedded Human Ovary with antibody at 8 ug/mL. Heat induced antigen retrieval with citrate buffer pH 6, HRP-staining.
Immunohistochemistry-Paraffin: OXTR Antibody [NBP2-76347] - Negative Control showing staining of paraffin embedded Human Ovary, with no primary antibody.
Species: Hu
Applications: Flow, IHC, IHC-P, PEP-ELISA
Oxytocin ELISA Kit
(Colorimetric)
NBP2-80261
ELISA: Universal Oxytocin ELISA Kit (Colorimetric) [NBP2-80261] - Standard Reference Curve
Applications: ELISA
V2 Vasopressin
R/AVPR2 Antibody - BS ...
NLS272
Immunohistochemistry-Paraffin: V2 Vasopressin R/AVPR2 Antibody [NLS272] - Ovary, carcinoma
Immunohistochemistry-Paraffin: V2 Vasopressin R/AVPR2 Antibody [NLS272] - Prostate, Carcinoma
Immunohistochemistry-Paraffin: V2 Vasopressin R/AVPR2 Antibody [NLS272] - Colon, carcinoma
(1 Publication)
Species: Ha, Hu, Pm, Mu, Rb, Rt
Applications: IHC, IHC-Fr, IHC-P
V1b Vasopressin
R/AVPR1B Antibody - B ...
NLS266
Immunohistochemistry-Paraffin: V1b Vasopressin R/AVPR1B Antibody [NLS266] - Brain, Pituitary, pars anterior
Immunohistochemistry-Paraffin: V1b Vasopressin R/AVPR1B Antibody [NLS266] - Analysis of anti-AVPR1B antibody with human brain, pituitary.
Immunohistochemistry-Paraffin: V1b Vasopressin R/AVPR1B Antibody [NLS266] - Analysis of anti-AVPR1B antibody with human adrenal, pheochromocytoma.
Species: Bt, Bv, Ca, Eq, Hu, Po, Rb, Rt
Applications: ICC/IF (-), IHC, IHC-P, WB (-)

Oxytocin/Neurophysin I
NBP2-68928
Immunohistochemistry-Paraffin: Oxytocin/Neurophysin I Antibody [NBP2-68928] - Staining of human hypothalamus shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: Oxytocin/Neurophysin I Antibody [NBP2-68928] - Staining of human ovary shows moderate cytoplasmic positivity in follicle cells.
Immunohistochemistry-Paraffin: Oxytocin/Neurophysin I Antibody [NBP2-68928] - Staining of human tonsil shows no positivity in germinal center cells as expected.
Species: Hu
Applications: IHC, IHC-P
gamma-Synuclein
Antibody (JM90-32)
NBP2-66861
Flow Cytometry: gamma-Synuclein Antibody (JM90-32) [NBP2-66861] - Analysis of Hela cells with gamma Synuclein antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black).
Immunocytochemistry/Immunofluorescence: gamma-Synuclein Antibody (JM90-32) [NBP2-66861] - Staining gamma Synuclein in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: gamma-Synuclein Antibody (JM90-32) [NBP2-66861] - Analysis of paraffin-embedded human breast cancer tissue using anti-gamma Synuclein antibody. Counter stained with hematoxylin.
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Secretin R Antibody
AF6387
Western blot shows lysates of human brain (cerebellum) tissue. PVDF Membrane was probed with 1 µg/mL of Human Secretin R Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6387) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Secretin R delta 3/4 at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: WB
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunohistochemistry: POMC Antibody [NB100-1533] - Representative immunofluorescence images of (B) POMC as a prohormone (n = 5-6 each) in the ARC of mice approximately 5 to 10 weeks of age. Image collected and cropped by CiteAb from the following publication (jci.org/articles/view/96420), licensed under a CC-BY licence.
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
RS1 Antibody
NBP2-56487
Immunohistochemistry-Paraffin: RS1 Antibody [NBP2-56487] - Staining of human eye, retina shows moderate positivity in photoreceptor cells and nerve fibers.
Immunohistochemistry-Paraffin: RS1 Antibody [NBP2-56487] - Staining of human liver shows no postivity in hepatocytes expected.
Immunohistochemistry-Paraffin: RS1 Antibody [NBP2-56487] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Species: Hu
Applications: IHC, IHC-P
RSC1A1 Antibody
H00006248-B01P
Immunocytochemistry/Immunofluorescence: RSC1A1 Antibody [H00006248-B01P] - Analysis of purified antibody to RSC1A1 on HeLa cell. (antibody concentration 10 ug/ml)
Immunohistochemistry-Paraffin: RSC1A1 Antibody [H00006248-B01P] - Analysis of purified antibody to RSC1A1 on formalin-fixed paraffin-embedded human endometrium. (antibody concentration 3 ug/ml)
Western Blot: RSC1A1 Antibody [H00006248-B01P] - Analysis of RSC1A1 expression in transfected 293T cell line by RSC1A1 polyclonal antibody. Lane 1: RSC1A1 transfected lysate(67.87 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Leucyl-cystinyl
Aminopeptidase/LNPEP ...
AF6386
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line. PVDF Membrane was probed with 1 µg/mL of Human Leucyl-cystinyl Aminopeptidase/LNPEP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6386) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Leucyl-cystinyl Aminopeptidase/LNPEP at approximately 170 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: IP, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot: PRRT2 Antibody [NBP2-82026] - Analysis of PRRT2 in mouse brain tissue lysate with PRRT2 antibody at 1 ug/ml.
Immunohistochemistry: PRRT2 Antibody [NBP2-82026] - Immunohistochemistry of PRRT2 in rat brain tissue with PRRT2 antibody at 2.5 ug/ml.
Immunocytochemistry/Immunofluorescence: PRRT2 Antibody [NBP2-82026] - Immunofluorescence of PRRT2 in rat brain tissue with PRRT2 antibody at 20 ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

SLC6A4/5-HTTLPR/Seroto ...
H00006532-D01P
Flow Cytometry: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Fixed and permeabilized mouse mast cells were stained for 1 hour in 4C then stained with PE secondary and ran on FACS. Image from verified customer review.
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Analysis of SLC6A4 expression in transfected 293T cell line by SLC6A4 polyclonal antibody. Lane 1: SLC6A4 transfected lysate (70.30 KDa). Lane 2: Non-transfected lysate.
Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody [H00006532-D01P] - Analysis of SLC6A4 expression in mouse lung.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB
Tyrosinase
Antibody (JA52-11)
NBP2-67232
Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in A431 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in MCF-7 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Analysis of paraffin-embedded human liver tissue using anti-Tyrosinase antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
GPR151 Antibody -
BSA Free
NLS418
Immunohistochemistry-Paraffin: GPR151 Antibody [NLS418] - Analysis of anti-GPR151 antibody with brain, thalamus at 2 ug/ ml.
Immunohistochemistry-Paraffin: GPR151 Antibody [NLS418] - Analysis of anti-GPR151 antibody with human brain, glioblastoma.
Immunohistochemistry-Paraffin: GPR151 Antibody [NLS418] - Anti-GPR151 antibody IHC of human Lung, Non-Small Cell Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Hu
Applications: IHC, IHC-P

Publications for V1a Vasopressin R/AVPR1A Antibody (NBP2-84325) (0)

There are no publications for V1a Vasopressin R/AVPR1A Antibody (NBP2-84325).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for V1a Vasopressin R/AVPR1A Antibody (NBP2-84325) (0)

There are no reviews for V1a Vasopressin R/AVPR1A Antibody (NBP2-84325). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for V1a Vasopressin R/AVPR1A Antibody (NBP2-84325) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional V1a Vasopressin R/AVPR1A Products

Bioinformatics Tool for V1a Vasopressin R/AVPR1A Antibody (NBP2-84325)

Discover related pathways, diseases and genes to V1a Vasopressin R/AVPR1A Antibody (NBP2-84325). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for V1a Vasopressin R/AVPR1A Antibody (NBP2-84325)

Discover more about diseases related to V1a Vasopressin R/AVPR1A Antibody (NBP2-84325).
 

Pathways for V1a Vasopressin R/AVPR1A Antibody (NBP2-84325)

View related products by pathway.

Research Areas for V1a Vasopressin R/AVPR1A Antibody (NBP2-84325)

Find related products by research area.

Blogs on V1a Vasopressin R/AVPR1A

There are no specific blogs for V1a Vasopressin R/AVPR1A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our V1a Vasopressin R/AVPR1A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol AVPR1A