V-type proton ATPase subunit F Recombinant Protein Antigen

Images

 
There are currently no images for V-type proton ATPase subunit F Protein (NBP2-38942PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

V-type proton ATPase subunit F Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP6V1F.

Source: E. coli

Amino Acid Sequence: DIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP6V1F
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38942.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for V-type proton ATPase subunit F Recombinant Protein Antigen

  • ATP6S14adenosinetriphosphatase 14k chain
  • ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F
  • H(+)-transporting two-sector ATPase, 14kD subunit
  • MGC117321
  • MGC126037
  • MGC126038
  • vacuolar ATP synthase subunit F
  • vacuolar proton pump F subunit
  • Vacuolar proton pump subunit F
  • VATFATPase, vacuolar, 14 kD
  • V-ATPase 14 kDa subunit
  • V-ATPase F subunit
  • V-ATPase subunit F
  • Vma7
  • V-type proton ATPase subunit F

Background

V-type proton ATPase subunit F encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is the V1 domain F subunit protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01991
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-31944
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-47916
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB300-270
Species: Ch, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, In vitro, Simple Western, WB
NBP1-32980
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC,  IHC-P, WB
NBP1-88894
Species: Hu
Applications: IHC,  IHC-P
H00009114-M01
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP1-59654
Species: Hu
Applications: WB
NBP2-83943
Species: Rt
Applications: WB
H00000534-M02
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-15520
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-12617
Species: Hu
Applications: IHC,  IHC-P, IP, WB
H00028299-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-84475
Species: Hu, Mu
Applications: IHC,  IHC-P
H00000537-M01
Species: Hu, Rt
Applications: ELISA, S-ELISA, WB
NBP3-35836
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-38942PEP
Species: Hu
Applications: AC

Publications for V-type proton ATPase subunit F Protein (NBP2-38942PEP) (0)

There are no publications for V-type proton ATPase subunit F Protein (NBP2-38942PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for V-type proton ATPase subunit F Protein (NBP2-38942PEP) (0)

There are no reviews for V-type proton ATPase subunit F Protein (NBP2-38942PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for V-type proton ATPase subunit F Protein (NBP2-38942PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional V-type proton ATPase subunit F Products

Blogs on V-type proton ATPase subunit F

There are no specific blogs for V-type proton ATPase subunit F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our V-type proton ATPase subunit F Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1F