UTS2D Antibody

Images

 
Western Blot: UTS2D Antibody [NBP1-79927] - Titration: 1.0 ug/ml Positive Control: 721_B Whole Cell.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UTS2D Antibody Summary

Immunogen
The immunogen for this antibody is UTS2D. Peptide sequence ALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UTS2D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against UTS2D and was validated on Western blot.
Theoretical MW
13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UTS2D Antibody

  • MGC138371
  • U2B
  • U-IIB
  • urotensin 2 domain containing
  • Urotensin IIB
  • Urotensin II-related peptide
  • Urotensin-2 domain-containing protein
  • urotensin-2B
  • URPUIIB
  • UTS2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87223
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00001325-P01
Species: Hu
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
9134-TN
Species: Hu
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-45641
Species: Hu
Applications: WB, IHC
NBP1-89883
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
AF1543
Species: Hu
Applications: WB, IHC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-79927
Species: Hu
Applications: WB

Publications for UTS2D Antibody (NBP1-79927) (0)

There are no publications for UTS2D Antibody (NBP1-79927).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UTS2D Antibody (NBP1-79927) (0)

There are no reviews for UTS2D Antibody (NBP1-79927). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UTS2D Antibody (NBP1-79927) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UTS2D Products

Bioinformatics Tool for UTS2D Antibody (NBP1-79927)

Discover related pathways, diseases and genes to UTS2D Antibody (NBP1-79927). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UTS2D Antibody (NBP1-79927)

Discover more about diseases related to UTS2D Antibody (NBP1-79927).
 

Pathways for UTS2D Antibody (NBP1-79927)

View related products by pathway.

PTMs for UTS2D Antibody (NBP1-79927)

Learn more about PTMs related to UTS2D Antibody (NBP1-79927).

Blogs on UTS2D

There are no specific blogs for UTS2D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UTS2D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UTS2D
Uniprot