USP9x Antibody (1C4)

Images

 
Western Blot: USP9x Antibody (1C4) [H00008239-M01] - USP9x in mouse ovarian cancer cell lysate using anti-USP9x antibody. The primary antibody was used at a dilution of 1:500 and incubated for overnight at 4C in 5% milk ...read more
Immunocytochemistry/ Immunofluorescence: USP9x Antibody (1C4) [H00008239-M01] - Analysis of monoclonal antibody to USP9X on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: USP9x Antibody (1C4) [H00008239-M01] - USP9X expression in Hela NE ( Cat # L013V3 ).
ELISA: USP9x Antibody (1C4) [H00008239-M01] - Detection limit for recombinant GST tagged USP9X is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, IP
Clone
1C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

USP9x Antibody (1C4) Summary

Immunogen
USP9X (NP_068706, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLP
Specificity
USP9X - ubiquitin specific peptidase 9, X-linked (fat facets-like, Drosophila)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
USP9X
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. Use in Immunohistochemistry-paraffin reported in scientific literature (PMID: 20023629).
Reviewed Applications
Read 1 Review rated 4
using
H00008239-M01 in the following applications:

Publications
Read Publications using
H00008239-M01 in the following applications:

  • 1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for USP9x Antibody (1C4)

  • Deubiquitinating enzyme FAF-X
  • DFFRX
  • DFFRXubiquitin specific protease 9, X-linked (fat facets-like, Drosophila)
  • Drosophila fat facets related, X-linked
  • EC 3.1.2.15
  • EC 3.4.19.12
  • FAF
  • FAM
  • Fat facets in mammals
  • fat facets protein related, X-linked
  • Fat facets protein-related, X-linked
  • hFAM
  • probable ubiquitin carboxyl-terminal hydrolase FAF-X
  • ubiquitin specific peptidase 9, X-linked (fat facets-like, Drosophila)
  • ubiquitin specific peptidase 9, X-linked
  • ubiquitin thioesterase FAF-X
  • Ubiquitin thiolesterase FAF-X
  • ubiquitin-specific processing protease FAF-X
  • Ubiquitin-specific protease 9, X chromosome
  • Ubiquitin-specific-processing protease FAF-X
  • USP9
  • USP9x
  • X chromosome (fat facets-like Drosophila)

Background

This gene is a member of the peptidase C19 family and encodes a protein that is similar to ubiquitin-specific proteases. Though this gene is located on the X chromosome, it escapes X-inactivation. Mutations in this gene have been associated with Turner syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86037
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67130
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-56853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS1049
Species: Hu, Po, Eq, Pm, Pm
Applications: ICC/IF, IHC, IHC-P, ICC
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-45628
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-79749
Species: Hu
Applications: WB
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
AF3749
Species: Hu
Applications: WB, IHC
NBP2-30455
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-03109
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67330
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-2564
Species: Hu
Applications: WB
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
H00008239-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for USP9x Antibody (H00008239-M01)(7)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC-P, WB.


Filter By Application
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for USP9x Antibody (H00008239-M01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using H00008239-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot USP9x H00008239-M01
Enlarge
4
reviewed by:
Verified Customer
WB Mouse 12/05/2014
View

Summary

ApplicationWestern Blot
Sample Testedmouse ovarian cancer cells
SpeciesMouse

Blocking

Blocking Details5%milk in PBST 1h RT

Primary Anitbody

Dilution Ratio1:500 O.N 4C in 5%milk in PBST

Secondary Antibody

Secondary DescriptionGoat anti mouse
Secondary Manufacturer Cat#H00008239-M01

Details

Detection NotesHRP

Comments

Commentscontrol and glucose starved cells for 17h

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for USP9x Antibody (H00008239-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional USP9x Products

Bioinformatics Tool for USP9x Antibody (H00008239-M01)

Discover related pathways, diseases and genes to USP9x Antibody (H00008239-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP9x Antibody (H00008239-M01)

Discover more about diseases related to USP9x Antibody (H00008239-M01).
 

Pathways for USP9x Antibody (H00008239-M01)

View related products by pathway.

PTMs for USP9x Antibody (H00008239-M01)

Learn more about PTMs related to USP9x Antibody (H00008239-M01).

Blogs on USP9x

There are no specific blogs for USP9x, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Verified Customer
12/05/2014
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol USP9X
Entrez
OMIM