USP52 Antibody (6A7)

Images

 
Immunocytochemistry/ Immunofluorescence: USP52 Antibody (6A7) [H00009924-M01] - Analysis of monoclonal antibody to PAN2 on HeLa cell . Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
6A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

USP52 Antibody (6A7) Summary

Immunogen
USP52 (NP_055686, 1099 a.a. ~ 1198 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TVYLFHMPRKRMISLRFLAWYFLDLKIQGETHDSIEDARTALQLYRKYLELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEGQTSPKNAAVFSSVLAL
Localization
Cytoplasmic and Nuclear. Note=Shuttles between nucleus and cytoplasm.
Specificity
USP52 - ubiquitin specific peptidase 52
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PAN2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for USP52 Antibody (6A7)

  • EC 3.1.13.4
  • FLJ39360
  • hPan2
  • Inactive ubiquitin carboxyl-terminal hydrolase 52
  • KIAA0710PAB-dependent poly(A)-specific ribonuclease subunit 2
  • NALP4
  • PABP-dependent poly(A) nuclease 2
  • PAN2 poly(A) specific ribonuclease subunit homolog (S. cerevisiae)
  • PAN2 polyA specific ribonuclease subunit
  • PYPAF4
  • ubiquitin specific peptidase 52
  • ubiquitin specific protease 52
  • USP52

Background

USP52 shows homology to the ubiquitin specific peptidase family. However, it has no ubiquitin carboxyl terminal hydrolase activity since it lacks a conserved catalytic Cys at position 525. It functions in cytoplasmic mRNA decay as part of the Pan nuclease complex which shortens poly(A) tails of RNA when the poly(A) stretch is bound by polyadenylate-binding protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for USP52 Antibody (H00009924-M01) (0)

There are no publications for USP52 Antibody (H00009924-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP52 Antibody (H00009924-M01) (0)

There are no reviews for USP52 Antibody (H00009924-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for USP52 Antibody (H00009924-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP52 Products

Research Areas for USP52 Antibody (H00009924-M01)

Find related products by research area.

Blogs on USP52

There are no specific blogs for USP52, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP52 Antibody (6A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol PAN2
Entrez
Uniprot