![Immunocytochemistry/Immunofluorescence: USP47 Antibody (1E6) [H00055031-M02] - Analysis of monoclonal antibody to USP47 on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/USP47-Antibody-1E6-Immunocytochemistry-Immunofluorescence-H00055031-M02-img0002.jpg "Immunocytochemistry/Immunofluorescence: USP47 Antibody (1E6) [H00055031-M02] - Analysis of monoclonal antibody to USP47 on HeLa cell . Antibody concentration 10 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 1E6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | USP47 (NP_060414, 203 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TEQADLINELYQGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQ |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | USP47 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody is useful for ELISA, Western Blot |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Immunocytochemistry HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Immunocytochemistry__Immunofluorescence_21675.jpg)
![Immunohistochemistry HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Immunohistochemistry_6763.jpg)
![Knockout Validated HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Knockout_Validated_22522.jpg)
| Publication using H00055031-M02 | Applications | Species |
|---|---|---|
| Zhu Y, Guo Y, Liu H et al. Ubiquitin specific peptidase 47 contributes to liver regeneration Life sciences 2023-07-22 [PMID: 37487274] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
![Bioactivity HGF [Unconjugated]](https://images.novusbio.com/images2/HGF_294HG_3253.jpg)
![Cell Culture HGF [Unconjugated]](https://images.novusbio.com/images/294-hg_recombinant-human-hgf-protein-cell-culture-252023111456.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]](https://images.novusbio.com/images2/Reg1A_MAB4937_Flow_Cytometry_8512.jpg)
![Immunohistochemistry-Paraffin: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] [NB7539] - FFPE serial sections of human stomach carcinoma. Primary Antibody: Mouse anti-p53 (Clone DO-1) used at a dilution of 1:100. Secondary Antibody: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] Conjugated used at a dilution of 1:200 (5ug/ml). Detection: DAB](https://images.novusbio.com/images/Goat-anti-Mouse-IgG-H+L-Secondary-Antibody-HRP-Immunohistochemistry-Paraffin-NB7539-img0014.jpg "Immunohistochemistry-Paraffin: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] [NB7539] - FFPE serial sections of human stomach carcinoma. Primary Antibody: Mouse anti-p53 (Clone DO-1) used at a dilution of 1:100. Secondary Antibody: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] Conjugated used at a dilution of 1:200 (5ug/ml). Detection: DAB")