Recombinant Human USP39 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human USP39 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 466-565 of Human USP39 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQGA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
USP39
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human USP39 Protein

  • CGI-21
  • HSPC332
  • Inactive ubiquitin-specific peptidase 39,65K
  • SAD1 homolog
  • SAD1MGC75069
  • small nuclear ribonucleoprotein 65kDa (U4/U6.U5)
  • SnRNP assembly defective 1 homolog
  • SNRNP65
  • U4/U6.U5 tri-snRNP-associated 65 kDa protein
  • U4/U6.U5 tri-snRNP-associated protein 2
  • ubiquitin specific peptidase 39
  • ubiquitin specific protease 39

Background

USP39 - ubiquitin specific protease 39

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14283
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80808
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC

Publications for USP39 Partial Recombinant Protein (H00010713-Q01) (0)

There are no publications for USP39 Partial Recombinant Protein (H00010713-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP39 Partial Recombinant Protein (H00010713-Q01) (0)

There are no reviews for USP39 Partial Recombinant Protein (H00010713-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP39 Partial Recombinant Protein (H00010713-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional USP39 Products

Bioinformatics Tool for USP39 Partial Recombinant Protein (H00010713-Q01)

Discover related pathways, diseases and genes to USP39 Partial Recombinant Protein (H00010713-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP39 Partial Recombinant Protein (H00010713-Q01)

Discover more about diseases related to USP39 Partial Recombinant Protein (H00010713-Q01).
 

Pathways for USP39 Partial Recombinant Protein (H00010713-Q01)

View related products by pathway.

Blogs on USP39

There are no specific blogs for USP39, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATM Antibody
NB100-104
USP39 Antibody
H00010713-B01P
HSP60 Antibody
NBP1-77397

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human USP39 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol USP39