Home » USP31 » USP31 Antibodies » USP31 Antibody (3B6)

USP31 Antibody (3B6)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: USP31 Antibody (3B6) [H00057478-M01] - USP31 monoclonal antibody (M01), clone 3B6 Analysis of USP31 expression in A-431.
Western Blot: USP31 Antibody (3B6) [H00057478-M01] - USP31 monoclonal antibody (M01), clone 3B6 Analysis of USP31 expression in A-431.
Immunocytochemistry/ Immunofluorescence: USP31 Antibody (3B6) [H00057478-M01] - Analysis of monoclonal antibody to USP31 on A-431 cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: USP31 Antibody (3B6) [H00057478-M01] - Detection limit for recombinant GST tagged USP31 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
3B6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

USP31 Antibody (3B6) Summary

Immunogen
USP31 (NP_065769, 1254 a.a. ~ 1352 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AGGSSVKSVCKNTGDDEAERGHQPPASQQPNANTTGKEQLVTKDPASAKHSLLSARKSKSSQLDSGVPSSPGGRQSAEKSSKKLSSSMQTSARPSQKPQ
Specificity
USP31 - ubiquitin specific peptidase 31
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
USP31
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for USP31 Antibody (3B6)

  • Deubiquitinating enzyme 31
  • EC 3.1.2.15
  • EC 3.4.19.12
  • KIAA1203ubiquitin specific proteinase 31
  • ubiquitin carboxyl-terminal hydrolase 31
  • ubiquitin specific peptidase 31
  • ubiquitin specific protease 31
  • ubiquitin thioesterase 31
  • Ubiquitin thiolesterase 31
  • Ubiquitin-specific-processing protease 31

Background

The ubiquitin-dependent protein degradation pathway is essential for the proteolysis of intracellular proteins and peptides. Deubiquitination, is catalyzed by proteases called deubiquitinating enzymes. USP31 (Ubiquitin specific peptidase 31) may be involved in the processing of ubiquinated proteins and poly-ubiquitin precursors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Immunofluorescence indicates NF-kB p65 subunit was expressed exclusively in AA-G groups and AST-G cytoplasm. High glucose stimulation impact on TSMCs in NF-kB pathway. (A) NF-kB p65 protein subunit expression in TSMCs in each group. (B) NF-kB p65 subunit immunofluorescence. Each number denotes different subunits. Alexa 488 green served as secondary antibodies.Citation: Hara K, Hamada C, Wakabayashi K, Kanda R, Kaneko K, Horikoshi S, et al. (2017) Scavenging of reactive oxygen species by astaxanthin inhibits epithelial-mesenchymal transition in high glucose-stimulated mesothelial cells. PLoS ONE 12(9): e0184332. https://doi.org/10.1371/journal.pone.0184332
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Standard curve using the internal RelA standard.
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Nuclear translocation of NF-kB p65 with LPS in Jurkat cells. Jurkat cells, grown to a density of 2X10(6) cells/ml, were treated with LPS (15 ug/ml). The cells were harvested at various indicated time points, and cell lysates were tested in Western analysis using NB100-56712 and also in this ELISA Kit.
(87 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
TRAF-2 Antibody
NB100-56173
Immunocytochemistry/Immunofluorescence: TRAF-2 Antibody [NB100-56173] - Immunostaining of HN30 and MCF-12a cells for TRAF2 3 days post-transfectionMCF-12a NT (DAPI): non-treated MCF-12a DAPI stained, MCF-12a NT (TRAF2-FITC): non-treated MCF-12a FITC stained for TRAF2, MCF-12a pNSP 5a3a (DAPI): MCF-12a transfected with pcDNA 3.0 NSP 5a3a DAPI stained, MCF-12a pNSP 5a3a (TRAF2-FITC): MCF-12a transfected with pcDNA 3.0 NSP 5a3a FITC stained for Traf-2, HN30 NT (DAPI): non-treated HN30 DAPI stained, HN30 NT (TRAF2-FITC): non-treated HN30 FITC stained for TRAF2, HN30 pNSP 5a3a (DAPI): HN30 transfected with pcDNA 3.0 NSP 5a3a DAPI stained, HN30 pNSP 5a3a (TRAF2-FITC): HN30 transfected with pcDNA 3.0 NSP 5a3a FITC stained for TRAF2. White arrows indicate apoptotic bodies. Image collected and cropped by Citeab from the following publication (A novel dual signaling axis for NSP 5a3a induced apoptosis in head and neck carcinoma. Oncotarget (2011) licensed under a CC-BY licence.
Immunohistochemistry: TRAF-2 Antibody [NB100-56173] - Formalin-fixed, paraffin-embedded human melanoma tissue section stained for TRAF2 at 1:2000. A1 is a higher magnification of A. Hematoxylin-eosin counterstain.
Immunohistochemistry-Paraffin: TRAF-2 Antibody [NB100-56173] - Formalin-fixed, paraffin-embedded human colon carcinoma tissue sections stained for TRAF2 using this antibody at 1:2000. Hematoxylin-eosin counterstain.
(3 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
UCH-L3 Antibody
NBP1-86037
Immunocytochemistry/Immunofluorescence: UCH-L3 Antibody [NBP1-86037] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: UCH-L3 Antibody [NBP1-86037] - Staining of human prostate shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: UCH-L3 Antibody [NBP1-86037] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CD40/TNFRSF5
Antibody (82102) [Unc ...
MAB6322
Western blot shows lysates of human spleen tissue. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human CD40/TNFRSF5 Monoclonal Antibody (Catalog # MAB6322) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for CD40/TNFRSF5 at approximately 40 kDa (as indicated). This experiment was conducted under non-reducing conditions and using Immunoblot Buffer Group 1.
In the presence of Recombinant Human IL‑4 (Catalog # 204-IL), Recombinant Human CD40 Ligand/TNFSF5 (Catalog # 6245-CL) stimulates proliferation in human B cell enriched peripheral blood mononuclear cells (PBMC) in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human CD40 Ligand/TNFSF5 (10 µg/mL) is neutralized (green line) by increasing concentrations of Human CD40/TNFRSF5 Monoclonal Antibody (Catalog # MAB6322). At 5 µg/mL, this anti-hCD40 antibody will neutralize approximately 80% of Recombinant Human CD40 Ligand/TNFSF5 -induced proliferation in the presence of Recombinant Human IL‑4 (20 ng/mL).
(7 Publications)
Species: Hu
Applications: Neut, WB
DUSP5 Antibody
(2F3)
H00001847-M04
Western Blot: DUSP5 Antibody (2F3) [H00001847-M04] - Analysis of DUSP5 expression in transfected 293T cell line by DUSP5 monoclonal antibody (M04), clone 2F3. Lane 1: DUSP5 transfected lysate (Predicted MW: 42.1 KDa). Lane 2: Non-transfected lysate.
Western Blot: DUSP5 Antibody (2F3) [H00001847-M04] - Western Blot analysis of DUSP5 expression in PC-12 ( Cat # L012V1 ).
Immunocytochemistry/Immunofluorescence: DUSP5 Antibody (2F3) [H00001847-M04] - Analysis of monoclonal antibody to DUSP5 on HeLa cell. Antibody concentration 10 ug/ml
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, WB
EphA3
640-A3
EphA3
(5 Publications)
Species: Mu
Applications: Bind
GRASP65 Antibody
(OTI5G8)
NBP2-02665
Immunocytochemistry/Immunofluorescence: GRASP65 Antibody (OTI5G8) [NBP2-02665] - Detection in cultured pig trabecular meshwork cells. Image from a verified customer review.
Immunocytochemistry/Immunofluorescence: GRASP65 Antibody (OTI5G8) [NBP2-02665] - Staining in Hela cells: red CFTR, Green GRASP65 and Blue is DAPI. Image from a verified customer review.
Flow Cytometry: GRASP65 Antibody (5G8) [NBP2-02665] - Analysis of Jurkat cells, using anti-GRASP65 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
(3 Reviews)
(1 Publication)
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
USP12 Antibody
NBP1-55441
Western Blot: USP12 Antibody [NBP1-55441] - Human Placenta lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
PINK1 Antibody
BC100-494
Immunohistochemistry-Paraffin: PINK1 Antibody [BC100-494] - Rabbit heart tissue. IHC-P image submitted by a verified customer review.
Western Blot: PINK1 Antibody [BC100-494] - Pathogenic mutants of Parkin are subjected to Ser65 phosphorylation. Phos-tag Western blotting for Parkin and Western blotting for PINK1 were performed using Parkin WT and a series of pathogenic mutants. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep01002) licensed under a CC-BY licence.
Knockdown Validated: PINK1 Antibody [BC100-494] - HEK293 cells were co-transfected with PINK1 siRNA (#1 or #2) or scrambled siRNA (scrambled) and untagged wild-type (WT) or Ser65Ala (S65A) mutant Parkin as indicated using TransFectin reagent (Bio-Rad). 48 hrs post-transfection, cells were treated with/without 10 uM CCCP for 3 h. 0.25 mg of 1% Triton whole-cell lysate were subjected to immunoprecipitation with GST-Parkin antibody (S966C) covalently coupled to protein G Sepharose and then immunoblotted with anti-phospho-Ser65 antibody in the presence of dephosphorylated peptide. 5% of the IP was immunoblotted with total anti-Parkin antibody. 0.25 mg of whole-cell lysates were immunoprecipitated with anti-PINK1 antibody (S085D) and immunoblotted with anti-PINK1 antibody. Representative of three independent experiments. Image collected and cropped by CiteAb from the following publication (http://rsob.royalsocietypublishing.org/cgi/doi/10.1098/rsob.120080) licensed under a CC-BY licence.
(13 Reviews)
(191 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PEP-ELISA, PAGE, WB
Synaptotagmin 1
Antibody
NBP1-91499
Western Blot: Synaptotagmin 1 Antibody [NBP1-91499] - Mouse Spleen Lysate 1ug/ml Gel Concentration 12%
Immunohistochemistry: Synaptotagmin 1 Antibody [NBP1-91499] - Sample Type: complete mouse retina sections. Red: Primary. Blue: DAPI. Primary Dilution: 1:200. Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L). Secondary Dilution: 1:200. Image Submitted by: David Zenisek. Yale University
Immunocytochemistry/Immunofluorescence: Synaptotagmin 1 Antibody [NBP1-91499] - Sample Type: outer mouse plexiform layer, Red: Primary, Blue: DAPI, Primary Dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary Dilution: 1:200, Image Submitted by: David Zenisek, Yale University.
(1 Review)
Species: Bv, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(677 Publications)
Species: Hu
Applications: BA
PDLIM7 Antibody
NBP1-84841
Immunohistochemistry-Paraffin: PDLIM7 Antibody [NBP1-84841] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Immunocytochemistry/Immunofluorescence: PDLIM7 Antibody [NBP1-84841] - Staining of human cell line U-251 MG shows localization to actin filaments and focal adhesion sites. Antibody staining is shown in green.
Western Blot: PDLIM7 Antibody [NBP1-84841] - PDLIM5/7 proteins localize in the cytoplasm in dense cells but to basal stress fibers in sparse cells and bind directly to the stress fiber component alpha-actinin 1. Co-immunoprecipitation of PDLIM5/7 proteins with GFP-tagged alpha-actinin 1 from human Caco2 cells. Results are representative of n=3 biological replicates. Image collected and cropped by CiteAb from the following publication (http://jcs.biologists.org/lookup/doi/10.1242/jcs.221788), licensed under a CC-BY licence.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TANK Antibody
NB100-56144
Immunohistochemistry: TANK Antibody - Unpurified [NB100-56144] - TANK Antibody [NB100-56144] - Immunohistochemical analysis of TANK/I-TRAF1 expression in formalin-fixed, paraffin-embedded normal human colon using this antibody at 1:2000. A-A3, low and high magnification images. Hematoxylin-eosin counterstain.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
TRAF-6 Inhibitor
Peptide Set
NBP2-26506
TRAF6 Inhibitor Peptide Set [NBP2-26506] - The TRAF6 inhibitory peptide inhibits osteoclast ifferentiation: RAW264.7 cells were plated on 24-well plates and stimulated with RANKL and M-CSF and incubated in the presence of different concentrations of control peptide (PTD) or the TRAF6. The TRAF6 at the concentration above 30 uM suppressed osteoclast differentiation.
(15 Publications)
Species: Hu, Mu, Rt
Applications: B/N, In vitro
WNK1 Antibody
NB600-225
Western Blot: WNK1 Antibody [NB600-225] - Detection of the short form of WNK1 in F-11 cell lysate.
Immunocytochemistry/Immunofluorescence: WNK1 Antibody [NB600-225] - WNK1 antibody was tested in HEK293 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
c-jun [p Ser63]
Antibody (SY0297)
NBP2-67471
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-Phospho-c-Jun(S63) antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NFkB p105/p50
Antibody (2J10D7)
NB100-56583
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on Jurkat cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on HeLa cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U2-OS cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(4 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
USP31 Antibody
(3B6)
H00057478-M01
USP31 Antibody (3B6)
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for USP31 Antibody (H00057478-M01) (0)

There are no publications for USP31 Antibody (H00057478-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP31 Antibody (H00057478-M01) (0)

There are no reviews for USP31 Antibody (H00057478-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for USP31 Antibody (H00057478-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional USP31 Products

Array H00057478-M01

Bioinformatics Tool for USP31 Antibody (H00057478-M01)

Discover related pathways, diseases and genes to USP31 Antibody (H00057478-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP31 Antibody (H00057478-M01)

Discover more about diseases related to USP31 Antibody (H00057478-M01).
 

Pathways for USP31 Antibody (H00057478-M01)

View related products by pathway.

Blogs on USP31

There are no specific blogs for USP31, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP31 Antibody (3B6) and receive a gift card or discount.


Bioinformatics

Gene Symbol USP31
Entrez
Uniprot