Home » USP31 » USP31 Antibodies » USP31 Antibody (3B6)

USP31 Antibody (3B6)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: USP31 Antibody (3B6) [H00057478-M01] - USP31 monoclonal antibody (M01), clone 3B6 Analysis of USP31 expression in A-431.
Western Blot: USP31 Antibody (3B6) [H00057478-M01] - USP31 monoclonal antibody (M01), clone 3B6 Analysis of USP31 expression in A-431.
Immunocytochemistry/ Immunofluorescence: USP31 Antibody (3B6) [H00057478-M01] - Analysis of monoclonal antibody to USP31 on A-431 cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: USP31 Antibody (3B6) [H00057478-M01] - Detection limit for recombinant GST tagged USP31 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
3B6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

USP31 Antibody (3B6) Summary

Immunogen
USP31 (NP_065769, 1254 a.a. ~ 1352 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AGGSSVKSVCKNTGDDEAERGHQPPASQQPNANTTGKEQLVTKDPASAKHSLLSARKSKSSQLDSGVPSSPGGRQSAEKSSKKLSSSMQTSARPSQKPQ
Specificity
USP31 - ubiquitin specific peptidase 31
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
USP31
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for USP31 Antibody (3B6)

  • Deubiquitinating enzyme 31
  • EC 3.1.2.15
  • EC 3.4.19.12
  • KIAA1203
  • KIAA1203ubiquitin specific proteinase 31
  • ubiquitin carboxyl-terminal hydrolase 31
  • ubiquitin specific peptidase 31
  • ubiquitin specific protease 31
  • ubiquitin thioesterase 31
  • Ubiquitin thiolesterase 31
  • Ubiquitin-specific-processing protease 31
  • USP31

Background

The ubiquitin-dependent protein degradation pathway is essential for the proteolysis of intracellular proteins and peptides. Deubiquitination, is catalyzed by proteases called deubiquitinating enzymes. USP31 (Ubiquitin specific peptidase 31) may be involved in the processing of ubiquinated proteins and poly-ubiquitin precursors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Immunofluorescence indicates NF-kB p65 subunit was expressed exclusively in AA-G groups and AST-G cytoplasm. High glucose stimulation impact on TSMCs in NF-kB pathway. (A) NF-kB p65 protein subunit expression in TSMCs in each group. (B) NF-kB p65 subunit immunofluorescence. Each number denotes different subunits. Alexa 488 green served as secondary antibodies.Citation: Hara K, Hamada C, Wakabayashi K, Kanda R, Kaneko K, Horikoshi S, et al. (2017) Scavenging of reactive oxygen species by astaxanthin inhibits epithelial-mesenchymal transition in high glucose-stimulated mesothelial cells. PLoS ONE 12(9): e0184332. https://doi.org/10.1371/journal.pone.0184332
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Standard curve using the internal RelA standard.
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Nuclear translocation of NF-kB p65 with LPS in Jurkat cells. Jurkat cells, grown to a density of 2X10(6) cells/ml, were treated with LPS (15 ug/ml). The cells were harvested at various indicated time points, and cell lysates were tested in Western analysis using NB100-56712 and also in this ELISA Kit.
(89 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
TRAF-2 Antibody
NB100-56173
Immunocytochemistry/Immunofluorescence: TRAF-2 Antibody [NB100-56173] - Immunostaining of HN30 and MCF-12a cells for TRAF2 3 days post-transfectionMCF-12a NT (DAPI): non-treated MCF-12a DAPI stained, MCF-12a NT (TRAF2-FITC): non-treated MCF-12a FITC stained for TRAF2, MCF-12a pNSP 5a3a (DAPI): MCF-12a transfected with pcDNA 3.0 NSP 5a3a DAPI stained, MCF-12a pNSP 5a3a (TRAF2-FITC): MCF-12a transfected with pcDNA 3.0 NSP 5a3a FITC stained for Traf-2, HN30 NT (DAPI): non-treated HN30 DAPI stained, HN30 NT (TRAF2-FITC): non-treated HN30 FITC stained for TRAF2, HN30 pNSP 5a3a (DAPI): HN30 transfected with pcDNA 3.0 NSP 5a3a DAPI stained, HN30 pNSP 5a3a (TRAF2-FITC): HN30 transfected with pcDNA 3.0 NSP 5a3a FITC stained for TRAF2. White arrows indicate apoptotic bodies. Image collected and cropped by Citeab from the following publication (A novel dual signaling axis for NSP 5a3a induced apoptosis in head and neck carcinoma. Oncotarget (2011) licensed under a CC-BY licence.
Immunohistochemistry: TRAF-2 Antibody [NB100-56173] - Formalin-fixed, paraffin-embedded human melanoma tissue section stained for TRAF2 at 1:2000. A1 is a higher magnification of A. Hematoxylin-eosin counterstain.
Immunohistochemistry-Paraffin: TRAF-2 Antibody [NB100-56173] - Formalin-fixed, paraffin-embedded human colon carcinoma tissue sections stained for TRAF2 using this antibody at 1:2000. Hematoxylin-eosin counterstain.
(3 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
UCH-L3 Antibody
NBP1-86037
Immunocytochemistry/Immunofluorescence: UCH-L3 Antibody [NBP1-86037] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: UCH-L3 Antibody [NBP1-86037] - Staining of human prostate shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: UCH-L3 Antibody [NBP1-86037] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CD40/TNFRSF5
Antibody (mAb89)
DDX0131P-100
Immunocytochemistry/Immunofluorescence: CD40/TNFRSF5 Antibody (mAb89) [DDX0131P-100] - CD40-transfected L cells stained.
Immunohistochemistry: CD40/TNFRSF5 Antibody (mAb89) [DDX0131P-100] - IHC staining on Bouin paraffinlymph node section. HumanCD40 stained with mAb 89.
(11 Publications)
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
DUSP5 Antibody
(2F3)
H00001847-M04
Western Blot: DUSP5 Antibody (2F3) [H00001847-M04] - Analysis of DUSP5 expression in transfected 293T cell line by DUSP5 monoclonal antibody (M04), clone 2F3. Lane 1: DUSP5 transfected lysate (Predicted MW: 42.1 KDa). Lane 2: Non-transfected lysate.
Western Blot: DUSP5 Antibody (2F3) [H00001847-M04] - Western Blot analysis of DUSP5 expression in PC-12 ( Cat # L012V1 ).
Immunocytochemistry/Immunofluorescence: DUSP5 Antibody (2F3) [H00001847-M04] - Analysis of monoclonal antibody to DUSP5 on HeLa cell. Antibody concentration 10 ug/ml
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, WB
EphA3
640-A3
EphA3
(6 Publications)
Species: Mu
Applications: Bind
GRASP65 Antibody
(OTI5G8)
NBP2-02665
Immunocytochemistry/Immunofluorescence: GRASP65 Antibody (OTI5G8) [NBP2-02665] - Detection in cultured pig trabecular meshwork cells. Image from a verified customer review.
Immunocytochemistry/Immunofluorescence: GRASP65 Antibody (OTI5G8) [NBP2-02665] - Staining in Hela cells: red CFTR, Green GRASP65 and Blue is DAPI. Image from a verified customer review.
Flow Cytometry: GRASP65 Antibody (5G8) [NBP2-02665] - Analysis of Jurkat cells, using anti-GRASP65 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
(3 Reviews)
(2 Publications)
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
USP12 Antibody
(OTI1E3)
NBP2-46298
Western Blot: USP12 Antibody (1E3) [NBP2-46298] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY USP12 .
Species: Hu, Mu, Rt
Applications: WB
PINK1 Antibody -
BSA Free
BC100-494
Immunohistochemistry-Paraffin: PINK1 Antibody [BC100-494] - Rabbit heart tissue. IHC-P image submitted by a verified customer review.
Western Blot: PINK1 Antibody [BC100-494] - Pathogenic mutants of Parkin are subjected to Ser65 phosphorylation. Phos-tag Western blotting for Parkin and Western blotting for PINK1 were performed using Parkin WT and a series of pathogenic mutants. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep01002) licensed under a CC-BY licence.
Knockdown Validated: PINK1 Antibody [BC100-494] - HEK293 cells were co-transfected with PINK1 siRNA (#1 or #2) or scrambled siRNA (scrambled) and untagged wild-type (WT) or Ser65Ala (S65A) mutant Parkin as indicated using TransFectin reagent (Bio-Rad). 48 hrs post-transfection, cells were treated with/without 10 uM CCCP for 3 h. 0.25 mg of 1% Triton whole-cell lysate were subjected to immunoprecipitation with GST-Parkin antibody (S966C) covalently coupled to protein G Sepharose and then immunoblotted with anti-phospho-Ser65 antibody in the presence of dephosphorylated peptide. 5% of the IP was immunoblotted with total anti-Parkin antibody. 0.25 mg of whole-cell lysates were immunoprecipitated with anti-PINK1 antibody (S085D) and immunoblotted with anti-PINK1 antibody. Representative of three independent experiments. Image collected and cropped by CiteAb from the following publication (http://rsob.royalsocietypublishing.org/cgi/doi/10.1098/rsob.120080) licensed under a CC-BY licence.
(13 Reviews)
(208 Publications)
Species: Hu, Mu, Rb, Rt
Applications: EM, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PEP-ELISA, PAGE, WB
Synaptotagmin 1
Antibody
NBP1-91499
Western Blot: Synaptotagmin 1 Antibody [NBP1-91499] - Mouse Spleen Lysate 1ug/ml Gel Concentration 12%
Immunohistochemistry: Synaptotagmin 1 Antibody [NBP1-91499] - Sample Type: complete mouse retina sections. Red: Primary. Blue: DAPI. Primary Dilution: 1:200. Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L). Secondary Dilution: 1:200. Image Submitted by: David Zenisek. Yale University
Immunocytochemistry/Immunofluorescence: Synaptotagmin 1 Antibody [NBP1-91499] - Sample Type: outer mouse plexiform layer, Red: Primary, Blue: DAPI, Primary Dilution: 1:200, Secondary Antibody: Goat anti-Rabbit AF568 IgG(H+L), Secondary Dilution: 1:200, Image Submitted by: David Zenisek, Yale University.
(1 Review)
Species: Bv, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(739 Publications)
Species: Hu
Applications: BA
PDLIM7 Antibody
NBP1-84841
Immunohistochemistry-Paraffin: PDLIM7 Antibody [NBP1-84841] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Immunocytochemistry/Immunofluorescence: PDLIM7 Antibody [NBP1-84841] - Staining of human cell line U-251 MG shows localization to actin filaments and focal adhesion sites. Antibody staining is shown in green.
Western Blot: PDLIM7 Antibody [NBP1-84841] - PDLIM5/7 proteins localize in the cytoplasm in dense cells but to basal stress fibers in sparse cells and bind directly to the stress fiber component alpha-actinin 1. Co-immunoprecipitation of PDLIM5/7 proteins with GFP-tagged alpha-actinin 1 from human Caco2 cells. Results are representative of n=3 biological replicates. Image collected and cropped by CiteAb from the following publication (http://jcs.biologists.org/lookup/doi/10.1242/jcs.221788), licensed under a CC-BY licence.
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TANK Antibody
NB100-56144
Immunohistochemistry: TANK Antibody - Unpurified [NB100-56144] - TANK Antibody [NB100-56144] - Immunohistochemical analysis of TANK/I-TRAF1 expression in formalin-fixed, paraffin-embedded normal human colon using this antibody at 1:2000. A-A3, low and high magnification images. Hematoxylin-eosin counterstain.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
TRAF-6 Inhibitor
Peptide Set
NBP2-26506
TRAF6 Inhibitor Peptide Set [NBP2-26506] - The TRAF6 inhibitory peptide inhibits osteoclast ifferentiation: RAW264.7 cells were plated on 24-well plates and stimulated with RANKL and M-CSF and incubated in the presence of different concentrations of control peptide (PTD) or the TRAF6. The TRAF6 at the concentration above 30 uM suppressed osteoclast differentiation.
(17 Publications)
Species: Hu, Mu, Rt
Applications: B/N, In vitro
WNK1 Antibody
[Unconjugated]
AF2849
Western blot shows lysates of DA3 mouse myeloma cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Mouse/Rat WNK1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2849) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for WNK1 at approximately 230 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
(2 Publications)
Species: Mu, Rt
Applications: WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western blot shows lysates of HEK293T human embryonic kidney cell line untreated (-) or treated (+) with 20 mJ/cm2 ultraviolet light (UV) with a 30 minute recovery. PVDF membrane was probed with 0.5 μg/mL of Rabbit Anti-Human Phospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-c‑Jun (S63) at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
c‑Junphosphorylated at S63 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line treated with Anisomycin using Rabbit Anti-HumanPhospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) at 1 μg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HEK293T human embryonic kidney cell line untreated (-) or treated (+) with 20 mJ/cm2 ultraviolet light (UV) with a 30 minute recovery, loaded at 0.2 mg/mL. A specific band was detected for Phospho-c‑Jun (S63) at approximately 49 kDa (as indicated) using 5 μg/mL of Rabbit Anti-Human Phospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on Jurkat cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on HeLa cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U2-OS cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
USP31 Antibody
(3B6)
H00057478-M01
USP31 Antibody (3B6)
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for USP31 Antibody (H00057478-M01) (0)

There are no publications for USP31 Antibody (H00057478-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP31 Antibody (H00057478-M01) (0)

There are no reviews for USP31 Antibody (H00057478-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for USP31 Antibody (H00057478-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP31 Products

Array H00057478-M01

Bioinformatics Tool for USP31 Antibody (H00057478-M01)

Discover related pathways, diseases and genes to USP31 Antibody (H00057478-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP31 Antibody (H00057478-M01)

Discover more about diseases related to USP31 Antibody (H00057478-M01).
 

Pathways for USP31 Antibody (H00057478-M01)

View related products by pathway.

Blogs on USP31

There are no specific blogs for USP31, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP31 Antibody (3B6) and receive a gift card or discount.


Bioinformatics

Gene Symbol USP31
Entrez
Uniprot