USP26 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

USP26 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human USP26
  
  

  Source: E.coli

  Amino Acid Sequence: VPENPKRKKYVKTSKFVAFDRIINPTKDLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTKNLLRP

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: USP26
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25220It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for USP26 Recombinant Protein Antigen

• Deubiquitinating enzyme 26
• EC 3.4.19.12
• MGC120066
• MGC120067
• MGC120068
• ubiquitin carboxyl-terminal hydrolase 26
• ubiquitin specific peptidase 26
• ubiquitin specific protease 26
• ubiquitin thioesterase 26
• Ubiquitin thiolesterase 26
• ubiquitin-specific processing protease 26
• Ubiquitin-specific-processing protease 26
• USP26

Background

The USP26 gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases and is a deubiquitinatingenzyme (DUB) with His and Cys domains. It is specifically expressed in testis tissue. Mutations in this gene have beenassociated with Sertol

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: USP26