Recombinant Human USP26 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human USP26 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human USP26 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAALFLRGFVQIGNCKTGISKSKEAFIEAVERKKKDRLVLYFKSGKYSTFRLSDNIQNVVLKSYRGNQNHLHLTLQNNNGLFIEGLSSTDAEQLKIFLDRVHQNEVQPPV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
USP26

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human USP26 Protein

  • Deubiquitinating enzyme 26
  • EC 3.4.19.12
  • MGC120066
  • MGC120067
  • MGC120068
  • ubiquitin carboxyl-terminal hydrolase 26
  • ubiquitin specific peptidase 26
  • ubiquitin specific protease 26
  • ubiquitin thioesterase 26
  • Ubiquitin thiolesterase 26
  • ubiquitin-specific processing protease 26
  • Ubiquitin-specific-processing protease 26
  • USP26

Background

USP26 - ubiquitin specific protease 26

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-84350
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15049
Species: Hu
Applications: WB, ICC/IF
NBP1-33633
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NB100-2437
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-85402
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
H00000072-D01P
Species: Hu
Applications: WB
AF5627
Species: Mu
Applications: WB
NBP2-14950
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP2-29997
Species: Hu
Applications: WB, ICC/IF, IHC-P

Publications for USP26 Partial Recombinant Protein (H00083844-Q01) (0)

There are no publications for USP26 Partial Recombinant Protein (H00083844-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP26 Partial Recombinant Protein (H00083844-Q01) (0)

There are no reviews for USP26 Partial Recombinant Protein (H00083844-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP26 Partial Recombinant Protein (H00083844-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional USP26 Products

Bioinformatics Tool for USP26 Partial Recombinant Protein (H00083844-Q01)

Discover related pathways, diseases and genes to USP26 Partial Recombinant Protein (H00083844-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP26 Partial Recombinant Protein (H00083844-Q01)

Discover more about diseases related to USP26 Partial Recombinant Protein (H00083844-Q01).
 

Pathways for USP26 Partial Recombinant Protein (H00083844-Q01)

View related products by pathway.

PTMs for USP26 Partial Recombinant Protein (H00083844-Q01)

Learn more about PTMs related to USP26 Partial Recombinant Protein (H00083844-Q01).

Blogs on USP26

There are no specific blogs for USP26, but you can read our latest blog posts.

Customers Who Bought This Also Bought

USP26 Antibody
NBP2-20830

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human USP26 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol USP26
Entrez