USP22 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: USP22 Antibody [NBP1-82941] - Staining of human cell line U-251 MG shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: USP22 Antibody [NBP1-82941] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells and glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP22 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP22
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
USP22 Protein (NBP1-82941PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for USP22 Antibody

  • Deubiquitinating enzyme 22
  • EC 3.1.2.15
  • EC 3.4.19.12
  • KIAA1063ubiquitin carboxyl-terminal hydrolase 22
  • KIAA1064
  • ubiquitin specific peptidase 22
  • ubiquitin specific peptidase 3-like
  • ubiquitin specific protease 22
  • Ubiquitin Thioesterase 22
  • Ubiquitin thiolesterase 22
  • ubiquitin-specific processing protease 22
  • Ubiquitin-specific-processing protease 22
  • USP22
  • USP3L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56633
Species: Hu
Applications: WB
NBP1-90598
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56183
Species: Hu
Applications: ICC/IF, IHC-P
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP1-42657
Species: Hu
Applications: IP (-), WB
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-82941
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for USP22 Antibody (NBP1-82941) (0)

There are no publications for USP22 Antibody (NBP1-82941).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP22 Antibody (NBP1-82941) (0)

There are no reviews for USP22 Antibody (NBP1-82941). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for USP22 Antibody (NBP1-82941) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP22 Products

Bioinformatics Tool for USP22 Antibody (NBP1-82941)

Discover related pathways, diseases and genes to USP22 Antibody (NBP1-82941). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP22 Antibody (NBP1-82941)

Discover more about diseases related to USP22 Antibody (NBP1-82941).
 

Pathways for USP22 Antibody (NBP1-82941)

View related products by pathway.

PTMs for USP22 Antibody (NBP1-82941)

Learn more about PTMs related to USP22 Antibody (NBP1-82941).
 

Research Areas for USP22 Antibody (NBP1-82941)

Find related products by research area.

Blogs on USP22

There are no specific blogs for USP22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP22 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP22
Entrez
Uniprot