We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

USP18 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related USP18 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-92566PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

USP18 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human USP18.

Source: E. coli

Amino Acid Sequence: AESSQSPADLEEKKEEDSNMKREQPRERPRAWDYPHGLVGLHNI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
USP18
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92566.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for USP18 Recombinant Protein Antigen

  • EC 3.1.2.15
  • EC 3.4.19.-
  • hUBP43
  • ISG15-specific-processing protease
  • ISG43
  • ISG43UBP43
  • ubiquitin specific peptidase 18
  • ubiquitin specific protease 18
  • ubl carboxyl-terminal hydrolase 18
  • ubl thioesterase 18,43 kDa ISG15-specific protease
  • Ubl thiolesterase 18
  • UBP43
  • USP18

Background

UBP43 (also known as ISG43, Ubl thiolesterase 18, ISG15-specific processing protease, 43 kDa ISG15-specific protease, ubiquitin specific protease 18 or USP18) is a member of the deubiquitinating protease family of enzymes, which removes ubiquitin adducts from a broad range of protein substrates. Deletion of the UBP43 gene in mouse leads to a massive increase of ISG15 conjugates in tissues indicating that UBP43 is a major ISG15-specific protease. UBP43 is the first ISG15-specific protease reported. Both ISG15 and UBP43 genes are known to be strongly induced by interferon, genotoxic stress, and viral infection. Thus UBP43 may be necessary to maintain a critical cellular balance of ISG15-conjugated proteins in both healthy and stressed organisms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

UL-553
Species: Hu
Applications: EnzAct
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP2-75547
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP3-33075
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
8499-IF
Species: Hu
Applications: BA
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-32905
Species: Bv, Hu, Pm, Rb
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF245
Species: Hu
Applications: CyTOF-ready, Flow, WB
H00006449-M06
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NB100-77284
Species: Hu
Applications: IHC,  IHC-P, IP, WB (-)
NBP1-85950
Species: Hu
Applications: IHC,  IHC-P, WB
H00051191-A01
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
375-TL
Species: Hu
Applications: BA
NBP1-77263
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-67741
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-77275
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF1083
Species: Mu
Applications: Flow, Neut, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB

Publications for USP18 Recombinant Protein Antigen (NBP1-92566PEP) (0)

There are no publications for USP18 Recombinant Protein Antigen (NBP1-92566PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP18 Recombinant Protein Antigen (NBP1-92566PEP) (0)

There are no reviews for USP18 Recombinant Protein Antigen (NBP1-92566PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for USP18 Recombinant Protein Antigen (NBP1-92566PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional USP18 Products

Array NBP1-92566PEP

Research Areas for USP18 Recombinant Protein Antigen (NBP1-92566PEP)

Find related products by research area.

Blogs on USP18

There are no specific blogs for USP18, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our USP18 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol USP18