USP18 Recombinant Protein Antigen

Product Discontinued

USP18 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human USP18.
  
  

  Source: E. coli

  Amino Acid Sequence: AESSQSPADLEEKKEEDSNMKREQPRERPRAWDYPHGLVGLHNI

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: USP18
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92566.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for USP18 Recombinant Protein Antigen

• EC 3.1.2.15
• EC 3.4.19.-
• hUBP43
• ISG15-specific-processing protease
• ISG43
• ISG43UBP43
• ubiquitin specific peptidase 18
• ubiquitin specific protease 18
• ubl carboxyl-terminal hydrolase 18
• ubl thioesterase 18,43 kDa ISG15-specific protease
• Ubl thiolesterase 18
• UBP43
• USP18

Background

UBP43 (also known as ISG43, Ubl thiolesterase 18, ISG15-specific processing protease, 43 kDa ISG15-specific protease, ubiquitin specific protease 18 or USP18) is a member of the deubiquitinating protease family of enzymes, which removes ubiquitin adducts from a broad range of protein substrates. Deletion of the UBP43 gene in mouse leads to a massive increase of ISG15 conjugates in tissues indicating that UBP43 is a major ISG15-specific protease. UBP43 is the first ISG15-specific protease reported. Both ISG15 and UBP43 genes are known to be strongly induced by interferon, genotoxic stress, and viral infection. Thus UBP43 may be necessary to maintain a critical cellular balance of ISG15-conjugated proteins in both healthy and stressed organisms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: USP18