USP10 Recombinant Protein Antigen

Images

 
There are currently no images for USP10 Protein (NBP1-83028PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

USP10 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human USP10.

Source: E.coli

Amino Acid Sequence: TDTTENLGVANGQILESSGEGTATNGVELHTTESIDLDPTKPESASPPADGTGSASGTLPVSQPKSWASLFHDSKPSSSSPVAYVETKYSPPAISPLVSEKQVEVKEGLVP

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
USP10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83028.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for USP10 Recombinant Protein Antigen

  • Deubiquitinating enzyme 10
  • EC 3.4.19.12
  • KIAA0190MGC2621
  • ubiquitin carboxyl-terminal hydrolase 10
  • ubiquitin specific peptidase 10
  • ubiquitin specific protease 10
  • ubiquitin thioesterase 10
  • Ubiquitin Thiolesterase 10
  • Ubiquitin-specific-processing protease 10
  • UBPO
  • Uchrp
  • USP10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86037
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-83404
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-22238
Species: Hu, Mu
Applications: WB, IP
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NB100-60555
Species: Hu
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-86588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB500-240
Species: Hu, Mu
Applications: WB, IP
AF262
Species: Hu
Applications: WB, IHC, ICC, Neut
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83028PEP
Species: Hu
Applications: AC

Publications for USP10 Protein (NBP1-83028PEP) (0)

There are no publications for USP10 Protein (NBP1-83028PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP10 Protein (NBP1-83028PEP) (0)

There are no reviews for USP10 Protein (NBP1-83028PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for USP10 Protein (NBP1-83028PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for USP10 Protein (NBP1-83028PEP)

Discover related pathways, diseases and genes to USP10 Protein (NBP1-83028PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP10 Protein (NBP1-83028PEP)

Discover more about diseases related to USP10 Protein (NBP1-83028PEP).
 

Pathways for USP10 Protein (NBP1-83028PEP)

View related products by pathway.

PTMs for USP10 Protein (NBP1-83028PEP)

Learn more about PTMs related to USP10 Protein (NBP1-83028PEP).

Blogs on USP10. Showing 1-10 of 49 blog posts - Show all blog posts.

Beclin 1: Regulator of Autophagy and Apoptosis
Beclin 1 is the mammalian orthologue of the yeast Apg6/Vps30 gene. Beclin 1 can complement the defect in autophagy present in apg6 yeast strains and stimulate autophagy when overexpressed in mammalian cells (1) and can bind to Bcl2, an important regul...  Read full blog post.

Beclin 1: Regulator of Autophagy and Apoptosis
Beclin 1 is the mammalian orthologue of the yeast Apg6/Vps30 gene. Beclin 1 can complement the defect in autophagy present in apg6 yeast strains and stimulate autophagy when overexpressed in mammalian cells (1) and can bind to Bcl2, an important regul...  Read full blog post.

Beclin 1: Regulator of Autophagy and Apoptosis
Beclin 1 is the mammalian orthologue of the yeast Apg6/Vps30 gene. Beclin 1 can complement the defect in autophagy present in apg6 yeast strains and stimulate autophagy when overexpressed in mammalian cells (1) and can bind to Bcl2, an important regul...  Read full blog post.

Beclin 1: Regulator of Autophagy and Apoptosis
Beclin 1 is the mammalian orthologue of the yeast Apg6/Vps30 gene. Beclin 1 can complement the defect in autophagy present in apg6 yeast strains and stimulate autophagy when overexpressed in mammalian cells (1) and can bind to Bcl2, an important regul...  Read full blog post.

Beclin 1: Regulator of Autophagy and Apoptosis
Beclin 1 is the mammalian orthologue of the yeast Apg6/Vps30 gene. Beclin 1 can complement the defect in autophagy present in apg6 yeast strains and stimulate autophagy when overexpressed in mammalian cells (1) and can bind to Bcl2, an important regul...  Read full blog post.

Beclin 1: Regulator of Autophagy and Apoptosis
Beclin 1 is the mammalian orthologue of the yeast Apg6/Vps30 gene. Beclin 1 can complement the defect in autophagy present in apg6 yeast strains and stimulate autophagy when overexpressed in mammalian cells (1) and can bind to Bcl2, an important regul...  Read full blog post.

Beclin 1: Regulator of Autophagy and Apoptosis
Beclin 1 is the mammalian orthologue of the yeast Apg6/Vps30 gene. Beclin 1 can complement the defect in autophagy present in apg6 yeast strains and stimulate autophagy when overexpressed in mammalian cells (1) and can bind to Bcl2, an important regul...  Read full blog post.

Beclin 1: Regulator of Autophagy and Apoptosis
Beclin 1 is the mammalian orthologue of the yeast Apg6/Vps30 gene. Beclin 1 can complement the defect in autophagy present in apg6 yeast strains and stimulate autophagy when overexpressed in mammalian cells (1) and can bind to Bcl2, an important regul...  Read full blog post.

Beclin 1: Regulator of Autophagy and Apoptosis
Beclin 1 is the mammalian orthologue of the yeast Apg6/Vps30 gene. Beclin 1 can complement the defect in autophagy present in apg6 yeast strains and stimulate autophagy when overexpressed in mammalian cells (1) and can bind to Bcl2, an important regul...  Read full blog post.

Beclin 1: Regulator of Autophagy and Apoptosis
Beclin 1 is the mammalian orthologue of the yeast Apg6/Vps30 gene. Beclin 1 can complement the defect in autophagy present in apg6 yeast strains and stimulate autophagy when overexpressed in mammalian cells (1) and can bind to Bcl2, an important regul...  Read full blog post.

Showing 1-10 of 49 blog posts - Show all blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our USP10 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol USP10
Entrez