Uroguanylin Antibody

Images

 
Western Blot: Uroguanylin Antibody [H00002981-D01P] - Analysis of GUCA2B expression in transfected 293T cell line by GUCA2B polyclonal antibody.Lane 1: GUCA2B transfected lysate(12.10 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Uroguanylin Antibody Summary

Description
Quality control test: Antibody reactive against mammalian transfected lysate.
Immunogen
GUCA2B (NP_009033.1, 1 a.a. - 112 a.a.) full-length human protein. MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL
Specificity
guanylate cyclase activator 2B (uroguanylin)
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GUCA2B
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against mammalian transfected lysate in WB. It has been used for ELISA.
Publications
Read Publication using H00002981-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Uroguanylin Antibody

  • GCAP-II
  • guanylate cyclase activator 2B (uroguanylin)
  • guanylate cyclase activator 2B
  • UGN
  • uroguanylin

Background

Uroguanylin and guanylin (GUCA2A; MIM 139392), peptide homologs of the bacterial heat-stable enterotoxins (e.g., the E. coli ST toxin; STa), are endogenous activators of the guanylate cyclase-2C receptor (GUCY2C; MIM 601330), which synthesizes cyclic GMP (cGMP), a key component of several intracellular signal transduction pathways.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Uroguanylin Antibody (H00002981-D01P)(1)

Reviews for Uroguanylin Antibody (H00002981-D01P) (0)

There are no reviews for Uroguanylin Antibody (H00002981-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Uroguanylin Antibody (H00002981-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Uroguanylin Products

Research Areas for Uroguanylin Antibody (H00002981-D01P)

Find related products by research area.

Blogs on Uroguanylin

There are no specific blogs for Uroguanylin, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Uroguanylin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GUCA2B
Entrez
Uniprot