UQCRFS1 Antibody [PE]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: PE

UQCRFS1 Antibody [PE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 141-274 of human UQCRFS1 (NP_005994.2).
  
  Sequence:
  SASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UQCRFS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for UQCRFS1 Antibody [PE]

• Complex III subunit 5
• Cytochrome b-c1 complex subunit 5
• cytochrome b-c1 complex subunit Rieske, mitochondrial
• EC 1.10.2.2
• Rieske iron-sulfur protein
• RIP1
• RIS1
• RISPUbiquinol-cytochrome c reductase iron-sulfur subunit
• ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1
• UQCR5

Background

RIP1 is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis Function: The transit peptide of the Rieske protein seems

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UQCRFS1