UQCRC2 Antibody

Images

 
Western Blot: UQCRC2 Antibody [H00007385-B01P] - Analysis of UQCRC2 expression in HepG2.
Immunocytochemistry/ Immunofluorescence: UQCRC2 Antibody [H00007385-B01P] - Analysis of purified antibody to UQCRC2 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: UQCRC2 Antibody [H00007385-B01P] - Analysis of UQCRC2 expression in transfected 293T cell line by UQCRC2 polyclonal antibody. Lane 1: UQCRC2 transfected lysate(49.83 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UQCRC2 Antibody Summary

Immunogen
UQCRC2 (NP_003357.2, 1 a.a. - 453 a.a.) full-length human protein. MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL
Specificity
ubiquinol-cytochrome c reductase core protein II
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
UQCRC2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against mammalian transfected lysate in WB, ELISA and IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UQCRC2 Antibody

  • Complex III subunit 2
  • Core protein II
  • cytochrome b-c1 complex subunit 2, mitochondrial
  • QCR2
  • ubiquinol-cytochrome c reductase core protein II
  • Ubiquinol-cytochrome-c reductase complex core protein 2
  • UQCR2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03825
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-20849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-32367
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NBP2-00478
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-93442
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31142
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-2859
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-92563
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-86802
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-78444
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for UQCRC2 Antibody (H00007385-B01P) (0)

There are no publications for UQCRC2 Antibody (H00007385-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UQCRC2 Antibody (H00007385-B01P) (0)

There are no reviews for UQCRC2 Antibody (H00007385-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UQCRC2 Antibody (H00007385-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UQCRC2 Products

Bioinformatics Tool for UQCRC2 Antibody (H00007385-B01P)

Discover related pathways, diseases and genes to UQCRC2 Antibody (H00007385-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UQCRC2 Antibody (H00007385-B01P)

Discover more about diseases related to UQCRC2 Antibody (H00007385-B01P).
 

Pathways for UQCRC2 Antibody (H00007385-B01P)

View related products by pathway.

PTMs for UQCRC2 Antibody (H00007385-B01P)

Learn more about PTMs related to UQCRC2 Antibody (H00007385-B01P).

Blogs on UQCRC2

There are no specific blogs for UQCRC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UQCRC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UQCRC2
Entrez
Uniprot