Recombinant Human UPP2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human UPP2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 317 of Human UPP2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASVIPASNRSMRSDRNTYVGKRFVHVKNPYLDLMDEDILYHLDLGTKTHNLPAMFGDVKFVCVGGSPNRMKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPSISIMLHELIKLLHHARCCDVTIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLVGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAFKAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLDRLDCDQINLPHDVLVEYQQRPQLLISNFIRRRLGLCD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
UPP2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UPP2 Protein

  • EC 2.4.2.3
  • liver-specific uridine phosphorylase
  • UDRPASE2
  • UP2
  • UPase 2
  • UPASE2
  • UrdPase 2
  • uridine phosphorylase 2
  • uridine phosphorylase-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4218
Species: Hu
Applications: WB, IHC
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30852
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12482
Species: Hu
Applications: IHC, IHC-P
NBP2-38904
Species: Hu
Applications: Flow, IHC, IHC-P
NBP2-46297
Species: Hu
Applications: WB, IHC
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF1936
Species: Hu
Applications: WB, IP
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
24790002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-60103
Species: Hu
Applications: WB, IHC
NB110-40591
Species: Hu
Applications: WB, IHC-P, IP
H00151531-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for UPP2 Recombinant Protein (H00151531-P01) (0)

There are no publications for UPP2 Recombinant Protein (H00151531-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UPP2 Recombinant Protein (H00151531-P01) (0)

There are no reviews for UPP2 Recombinant Protein (H00151531-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UPP2 Recombinant Protein (H00151531-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UPP2 Products

Bioinformatics Tool for UPP2 Recombinant Protein (H00151531-P01)

Discover related pathways, diseases and genes to UPP2 Recombinant Protein (H00151531-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UPP2 Recombinant Protein (H00151531-P01)

Discover more about diseases related to UPP2 Recombinant Protein (H00151531-P01).
 

Pathways for UPP2 Recombinant Protein (H00151531-P01)

View related products by pathway.

Research Areas for UPP2 Recombinant Protein (H00151531-P01)

Find related products by research area.

Blogs on UPP2

There are no specific blogs for UPP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TPR Antibody
NB100-2866

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UPP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UPP2