We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

UPF3A Recombinant Protein Antigen

Images

 
There are currently no images for UPF3A Protein (NBP1-83136PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

UPF3A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UPF3A.

Source: E. coli

Amino Acid Sequence: KARPMEGSLEEPQETSHSGSDKEHRDVERSQEQESEAQRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UPF3A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83136.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for UPF3A Recombinant Protein Antigen

  • HUPF3A
  • Nonsense mRNA reducing factor 3A
  • regulator of nonsense transcripts 3A
  • RENT3AUp-frameshift suppressor 3 homolog A
  • UPF3 regulator of nonsense transcripts homolog A (yeast)
  • UPF3hUpf3

Background

UPF3A encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome 13. Two splice variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-368
Species: Hu, Mu
Applications: WB
NBP2-94094
Species: Hu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-83134
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-82024
Species: Hu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-88376
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF482
Species: Mu
Applications: IHC, WB
NBP2-33711
Species: Hu
Applications: IHC,  IHC-P
MAB41051
Species: Hu, Mu
Applications: WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33581
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-48848
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00010921-M05
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
NBP1-30321
Species: Hu
Applications: IHC,  IHC-P, IP, WB (-)
NBP1-47272
Species: Hu
Applications: IP, WB (-)
H00055110-B01P
Species: Hu
Applications: ICC/IF, WB
H00004116-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-82018
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85268
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-92410
Species: Hu
Applications: ICC/IF, IHC,  IHC-P

Publications for UPF3A Protein (NBP1-83136PEP) (0)

There are no publications for UPF3A Protein (NBP1-83136PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UPF3A Protein (NBP1-83136PEP) (0)

There are no reviews for UPF3A Protein (NBP1-83136PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for UPF3A Protein (NBP1-83136PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UPF3A Products

Array NBP1-83136PEP

Blogs on UPF3A

There are no specific blogs for UPF3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our UPF3A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol UPF3A