Recombinant Human UPF3A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human UPF3A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 274-374 of Human UPF3A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TGGGKQESCAPGAVVKARPMEGSLEEPQETSHSGSDKEHRDVERSQEQESEAQRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAP

Protein/Peptide Type
Partial Recombinant Protein
Gene
UPF3A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UPF3A Protein

  • HUPF3A
  • Nonsense mRNA reducing factor 3A
  • regulator of nonsense transcripts 3A
  • RENT3AUp-frameshift suppressor 3 homolog A
  • UPF3 regulator of nonsense transcripts homolog A (yeast)
  • UPF3hUpf3

Background

This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome 13. Two splice variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-368
Species: Hu
Applications: WB
NBP2-20813
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-83134
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58599
Species: Hu
Applications: ICC/IF
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-33598
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00010921-M05
Species: Hu
Applications: WB, ELISA, IP
NBP1-30321
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NBP2-57560
Species: Hu
Applications: ICC/IF
H00055110-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-46689
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82018
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85268
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-92410
Species: Hu
Applications: WB (-), ICC/IF, IHC, IHC-P

Publications for UPF3A Partial Recombinant Protein (H00065110-Q02) (0)

There are no publications for UPF3A Partial Recombinant Protein (H00065110-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UPF3A Partial Recombinant Protein (H00065110-Q02) (0)

There are no reviews for UPF3A Partial Recombinant Protein (H00065110-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UPF3A Partial Recombinant Protein (H00065110-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UPF3A Products

Bioinformatics Tool for UPF3A Partial Recombinant Protein (H00065110-Q02)

Discover related pathways, diseases and genes to UPF3A Partial Recombinant Protein (H00065110-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UPF3A Partial Recombinant Protein (H00065110-Q02)

Discover more about diseases related to UPF3A Partial Recombinant Protein (H00065110-Q02).
 

Pathways for UPF3A Partial Recombinant Protein (H00065110-Q02)

View related products by pathway.

PTMs for UPF3A Partial Recombinant Protein (H00065110-Q02)

Learn more about PTMs related to UPF3A Partial Recombinant Protein (H00065110-Q02).

Blogs on UPF3A

There are no specific blogs for UPF3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

UPF3A Antibody (2E2)
H00065110-M06

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UPF3A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UPF3A